Medicago truncatula (barrel medic): 11429668 Help Entry 11429668          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11429668    04120 Ubiquitin mediated proteolysis     11429668   09126 Chromosome    03083 Polycomb repressive complex     11429668  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11429668    04121 Ubiquitin system [BR:mtr04121]     11429668    03036 Chromosome and associated proteins [BR:mtr03036]     11429668 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11429668 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11429668    Cul7 complex      11429668 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11429668   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11429668 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  11429668 NCBI-ProteinID:  XP_003605505 UniProt:  G7JN65 LinkDB All DBs Position 4:11645596..11646090 Genome browser AA seq 164 aa AA seqDB search MSDGVESSTATKKITLKSSDNETFEIEKAVALESQTIKHLIDDNCADDSGIPLPNVTGKI LAMVIEHCKKHVDATSSDEKPSEDEINKWDTEFVKVDQDTLFDLILAANYLNIKSLLDLT CKTVADMIKGRTPEEIRKTFNIINDYTPEEEEEVRSETQWAFDE NT seq 495 nt NT seq  +upstreamnt  +downstreamnt atgtctgacggtgttgaatcatcaacggcgacgaagaagatcacactgaagagttccgac aacgagaccttcgaaattgaaaaggcggtggcattagaatctcaaacgatcaagcatttg atcgatgacaattgtgccgacgacagtggaatccctcttccaaacgttaccggcaagatc ttggctatggttattgagcattgcaagaagcatgttgacgctaccagttctgatgaaaag ccctctgaagatgaaattaacaaatgggacactgaattcgtcaaggttgaccaagatacc ctcttcgatctcatcttggctgcaaactatctaaacatcaaaagtctgctggatcttaca tgcaagactgtagcagacatgatcaagggtaggacgccggaggagattcgtaagactttc aacattattaatgattacactccggaggaagaggaggaagtccgtagcgaaactcaatgg gcttttgacgaatga

DBGET integrated database retrieval system