Medicago truncatula (barrel medic): 11430287 Help Entry 11430287          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11430287    04120 Ubiquitin mediated proteolysis     11430287   09126 Chromosome    03083 Polycomb repressive complex     11430287  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11430287    04121 Ubiquitin system [BR:mtr04121]     11430287    03036 Chromosome and associated proteins [BR:mtr03036]     11430287 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11430287 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11430287    Cul7 complex      11430287 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11430287   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11430287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  11430287 NCBI-ProteinID:  XP_003612225 UniProt:  Q155U3 LinkDB All DBs Position 5:9001719..9003566 Genome browser AA seq 155 aa AA seqDB search MSSTRKITLKSSDGETFEVDEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVEAAAAEEKPSEDEIKSWDGEFVKVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFSPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaacaagaaagatcactctcaagagttccgatggcgagaccttcgaggtcgat gaagctgttgctttggaatctcagacgatcaagcatatgatcgaagatgattgcgctgac agtggaatccctcttcccaacgttaccagtaagatcttggcgaaggtgattgagtattgc aagaagcatgttgaggctgctgctgctgaagagaagccttctgaggatgagattaagagc tgggatggtgagtttgttaaggttgaccaggctacgcttttcgatctcatcttggctgct aactacttgaatatcaagagcttgctggatcttacctgccaaactgttgcagacatgatc aagggaaaaacaccagaggagatccgcaagacattcaacatcaagaatgacttctcacct gaggaagaggaggaagttcgtagggaaaaccaatgggcatttgaatga

DBGET integrated database retrieval system