Medicago truncatula (barrel medic): 11435674 Help Entry 11435674          CDS       T01716                                  Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism mtr  Medicago truncatula (barrel medic) Brite KEGG Orthology (KO) [BR:mtr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:mtr03041]     11435674   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mtr04052]     11435674 Spliceosome [BR:mtr03041]  Complex B   Other components    Complex B specific factors     11435674 Cytokines and neuropeptides [BR:mtr04052]  Neuropeptides   Unclassified    11435674 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Ubiquitin_4 OTU1_UBXL Crinkler Motif Other DBs NCBI-GeneID:  11435674 NCBI-ProteinID:  XP_003601666 UniProt:  G7JAQ0 LinkDB All DBs Position 3:41468295..41470668 Genome browser AA seq 73 aa AA seqDB search MIEVVLNDRLGKKVRVKCNSDDTIGDLKKLVAAQTGTRADKIRIQKWYTIYKDHITLGDY EIHDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgattgaggttgtgttgaacgatcgattggggaagaaggtacgtgtgaagtgcaattca gatgacacgatcggtgatttgaagaagctggtggctgctcagaccggaactagggctgac aagatccgaattcagaagtggtacaccatctacaaggatcacatcactctcggtgattac gagatccatgatggcatgggtcttgaactctactacaactaa

DBGET integrated database retrieval system