Medicago truncatula (barrel medic): 11436534 Help Entry 11436534          CDS       T01716                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism mtr  Medicago truncatula (barrel medic) Pathway mtr04016   MAPK signaling pathway - plant mtr04070   Phosphatidylinositol signaling system mtr04075   Plant hormone signal transduction mtr04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:mtr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     11436534    04070 Phosphatidylinositol signaling system     11436534    04075 Plant hormone signal transduction     11436534  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     11436534  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mtr01009]     11436534   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11436534    03036 Chromosome and associated proteins [BR:mtr03036]     11436534   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mtr04147]     11436534 Protein phosphatases and associated proteins [BR:mtr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      11436534 Membrane trafficking [BR:mtr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     11436534 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      11436534 Exosome [BR:mtr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    11436534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EF-hand_FSTL1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 SAPC2_N Dockerin_1 DUF5580_M EFhand_Ca_insen Caleosin EF-hand_EFHB_C FCaBP_EF-hand MotA_activ PA_Ig-like EF-hand_STIM1 MecA_N SPEF2_C DUF6279 SurA_N_3 Motif Other DBs NCBI-GeneID:  11436534 NCBI-ProteinID:  XP_039683516 LinkDB All DBs Position 7:complement(40876920..40878750) Genome browser AA seq 149 aa AA seqDB search MADQLTDDQISEFKEAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYDEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagatcaactaacagatgatcagatctctgaattcaaagaagcatttagcttgttt gataaagatggtgatggttccatcacaacaaaggagcttggaaccgtgatgaggtcatta ggccagaatccaacagaggcagagctacaagacatgataaacgaagtagatgccgatggt aacggcacaatcgattttcctgaatttctaaaccttatggcaaggaaaatgaaagacaca gattcagaagaagaactgaaagaagcgtttagagtgttcgacaaggatcagaatggattc atttctgctgctgaactgcgccatgtaatgaccaaccttggtgaaaagcttactgatgaa gaagttgatgaaatgattcgagaggctgatgttgatggtgatggtcaaattaattatgat gagtttgttaaggttatgatggccaagtga

DBGET integrated database retrieval system