Medicago truncatula (barrel medic): 11443849 Help Entry 11443849          CDS       T01716                                  Name (RefSeq) SKP1-like protein 11   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11443849    04120 Ubiquitin mediated proteolysis     11443849   09126 Chromosome    03083 Polycomb repressive complex     11443849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11443849    04121 Ubiquitin system [BR:mtr04121]     11443849    03036 Chromosome and associated proteins [BR:mtr03036]     11443849 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11443849 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11443849    Cul7 complex      11443849 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11443849   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11443849 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DUF5035 Motif Other DBs NCBI-GeneID:  11443849 NCBI-ProteinID:  XP_003593886 UniProt:  G7IP52 LinkDB All DBs Position 2:complement(6135968..6136417) Genome browser AA seq 149 aa AA seqDB search MSISLRTADGVVFEATPSLTKNMKTVRTIIEDSDANVSVIPLLNVSSSHINKIVEYQTLS DDDKVKEFSVEDLNNDELKEFLLAVHYLNMESLFEVLTQAVADRIKNKNVVYVRNYFGIE NDLTAEEEAAIRFKNSWTFDGAEVEPEEE NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atgtcaatctctctcagaactgcagacggcgtcgttttcgaagccacaccatctctcacc aagaacatgaaaaccgttcgaaccatcatcgaagactccgacgccaacgtctccgtcatt cctctcctcaacgtctcttcttcccacatcaacaagatcgtcgagtaccaaactctctcc gatgacgataaggtgaaggagttttccgtcgaggatctcaacaacgatgagttgaaggag tttcttcttgctgttcattacttgaatatggagagtctttttgaggttttgactcaggct gttgcggatcggatcaagaataagaatgttgtgtatgtgagaaactattttggtatcgag aatgatcttacggcggaggaagaggcggcgattcgttttaagaatagttggacttttgat ggtgctgaagttgaacctgaagaggagtga

DBGET integrated database retrieval system