Medicago truncatula (barrel medic): 11445600 Help Entry 11445600          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     11445600    04120 Ubiquitin mediated proteolysis     11445600   09126 Chromosome    03083 Polycomb repressive complex     11445600  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     11445600    04121 Ubiquitin system [BR:mtr04121]     11445600    03036 Chromosome and associated proteins [BR:mtr03036]     11445600 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     11445600 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      11445600    Cul7 complex      11445600 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      11445600   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      11445600 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  11445600 NCBI-ProteinID:  XP_003621659 UniProt:  G7KSZ3 LinkDB All DBs Position 7:7206504..7206974 Genome browser AA seq 156 aa AA seqDB search MSSTTKKITLKSSDNETFEVPEAVALELQTIKHMIKDDCTDNGILVPNVTGQILAKVIEY CKKHIDAASSDEKPSEDDLKNWDAEFVKVHQTTLFDLILAANDLNIKSLLDLTCQYVADM IKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAVE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaaccaccaagaagatcactctcaagagttccgacaacgaaacctttgaggtt cctgaggctgtggcacttgaattgcagacaatcaagcacatgatcaaggacgattgcacg gacaacggaatcctagttcctaacgtgaccggtcagatattggcgaaggtgattgaatac tgtaagaagcatatcgatgccgcgagttccgatgaaaaaccttcagaagatgatcttaag aattgggatgctgaatttgtgaaggttcatcagactacgcttttcgatctcattcttgct gcaaatgacttgaatatcaagagtctattggatcttacctgccagtatgtggcggacatg atcaaagggaagacaccggaggaaattcgaaagacttttaatatcaagaatgatttcact ccggaggaagaggaagaagttcgtagggaaaatcaatgggcagttgaatga

DBGET integrated database retrieval system