Medicago truncatula (barrel medic): 25490092 Help Entry 25490092          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     25490092    04120 Ubiquitin mediated proteolysis     25490092   09126 Chromosome    03083 Polycomb repressive complex     25490092  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     25490092    04121 Ubiquitin system [BR:mtr04121]     25490092    03036 Chromosome and associated proteins [BR:mtr03036]     25490092 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     25490092 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      25490092    Cul7 complex      25490092 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      25490092   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      25490092 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB DapH_N Motif Other DBs NCBI-GeneID:  25490092 NCBI-ProteinID:  XP_013461980 UniProt:  G7ZWL4 LinkDB All DBs Position 3:54320926..54321813 Genome browser AA seq 158 aa AA seqDB search MSSYTKKITLNSSDGETFKVSKMVARESQVIKHMIEEDCANEAIPLQDVTANILAMVIEY CKKHVDAAAASSDGKPSEDDLEDWDAEFVKVDKGTLFNLIDAANYLEIKSLLDLTCQTVA DMMKGKTPEEIRNTFNIENDFTPQEEEEVRRENQWAFE NT seq 477 nt NT seq  +upstreamnt  +downstreamnt atgtcttcatacaccaagaagatcactctcaacagttccgacggcgaaaccttcaaagtt tccaagatggtggcacgtgaatcgcaggtgatcaagcatatgatcgaggaagattgtgcc aatgaagcaatccctcttcaggacgtcaccgcaaatattttggctatggtgattgaatac tgtaagaagcatgtcgatgccgccgcagcaagttctgatggaaaaccttcagaagatgat cttgaggattgggatgctgaatttgtgaaggttgataagggtacgcttttcaacctcatt gatgctgcaaactatttggaaatcaagagcttgttggatcttacttgccaaactgtggcg gacatgatgaaagggaagacaccggaggaaattcgaaacacttttaacatcgagaacgat ttcactccgcaggaagaggaagaagttcgaagggaaaatcaatgggcatttgaatga

DBGET integrated database retrieval system