Medicago truncatula (barrel medic): 25492546 Help Entry 25492546          CDS       T01716                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism mtr  Medicago truncatula (barrel medic) Pathway mtr04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     25492546  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mtr04121]     25492546    03400 DNA repair and recombination proteins [BR:mtr03400]     25492546 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      25492546    Cul5 complex      25492546 DNA repair and recombination proteins [BR:mtr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      25492546 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ BTB Motif Other DBs NCBI-GeneID:  25492546 NCBI-ProteinID:  XP_013456162 UniProt:  I3SR24 LinkDB All DBs Position 4:32399383..32400842 Genome browser AA seq 98 aa AA seqDB search MKKEDTVKLISSDGFEFVVDKEAAMVSQTIRNMLTSPGSFAEREHGQVTFPEISSTILEK ICQYFYWHLEFASGKDREFPIEPELTLELMMAANYLHT NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgaagaaggaagatacagtgaagctaatcagttccgatggattcgaattcgtcgttgac aaagaagctgccatggtttcacaaaccattcgcaacatgcttacctctccagggagtttt gctgaaagggaacacggacaagtaacttttcctgagattagttccactattcttgagaag atttgtcagtatttttattggcatcttgaatttgctagtggaaaggacagagagtttcct attgaacctgaattaactctggagttaatgatggctgccaattacctacatacttga

DBGET integrated database retrieval system