Medicago truncatula (barrel medic): 25499058 Help Entry 25499058          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     25499058    04120 Ubiquitin mediated proteolysis     25499058   09126 Chromosome    03083 Polycomb repressive complex     25499058  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     25499058    04121 Ubiquitin system [BR:mtr04121]     25499058    03036 Chromosome and associated proteins [BR:mtr03036]     25499058 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     25499058 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      25499058    Cul7 complex      25499058 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      25499058   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      25499058 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DarP Motif Other DBs NCBI-GeneID:  25499058 NCBI-ProteinID:  XP_013449664 UniProt:  A0A072U1W2 LinkDB All DBs Position 7:complement(44326722..44327434) Genome browser AA seq 159 aa AA seqDB search MSSTTTKMITLKSYDNEIFEVPEAVALESQTIKHMIEDDCADNAIPVQNVTGKILAKVIE YCKKHVQVASADEKPSESEEYLKNWDADFVKVDKETLFELILAANYLDIKSLLDLTCQSA ADMMKGKTPEEMREMFNIKNDFSPEEEAAIRAENKWAFE NT seq 480 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaacaaccacgaagatgatcaccctgaagagttacgacaacgaaatctttgag gtccccgaggcggtggcgctcgaatcacagacaatcaagcacatgatcgaggacgattgt gccgacaacgcaatcccagttcagaacgttaccggcaagatattagcgaaggtgattgaa tactgcaagaagcatgtgcaggtggcgagtgccgatgaaaaaccttcagaatcagaagaa tatcttaagaattgggatgctgatttcgttaaggttgataaggagacgctttttgaactc atccttgctgcaaactacttggatatcaagagtctactggatcttacctgccagtctgcg gcggacatgatgaaagggaagacgcccgaggaaatgcgtgagatgtttaacatcaagaat gatttcagtccagaggaagaagcagcaattcgtgcagaaaacaaatgggcatttgaatga

DBGET integrated database retrieval system