Medicago truncatula (barrel medic): 25499062 Help Entry 25499062          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     25499062    04120 Ubiquitin mediated proteolysis     25499062   09126 Chromosome    03083 Polycomb repressive complex     25499062  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     25499062    04121 Ubiquitin system [BR:mtr04121]     25499062    03036 Chromosome and associated proteins [BR:mtr03036]     25499062 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     25499062 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      25499062    Cul7 complex      25499062 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      25499062   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      25499062 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  25499062 NCBI-ProteinID:  XP_013449668 UniProt:  A0A072U2S6 LinkDB All DBs Position 7:complement(44341178..44341692) Genome browser AA seq 156 aa AA seqDB search MSSTTKKITLKSSDNETFEVPEAVALESQTIKYMIEDDCTDNGIPVPNVTGQILAKVIEY CKKHVDAASSDEKPSEDDLKNWDAEFVKVDQATLFGLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIRKTFNIKNDFTSEEEEEIRRENQWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaaccaccaagaagatcactctcaagagttccgacaacgaaacctttgaggtt cccgaggcggtggcacttgaatcgcagacgatcaagtacatgatcgaggacgattgtacc gacaacggaattccagttcctaacgtgaccggtcagatattggcgaaggtgatagaatac tgtaagaagcatgttgatgccgcgagttccgatgaaaaaccatccgaagatgatcttaag aattgggatgctgaattcgtaaaggttgatcaggctacgcttttcggtctcattcttgct gcaaattacttgaatatcaagagtctactggatcttacctgccagactgtggcggacatg atcaaagggaagacgccggaggaaattcgaaagacttttaatatcaagaatgatttcact tcggaggaagaggaagaaattcgtagggaaaatcaatgggcatttgaatga

DBGET integrated database retrieval system