Medicago truncatula (barrel medic): 25499080 Help Entry 25499080          CDS       T01716                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism mtr  Medicago truncatula (barrel medic) Pathway mtr03083   Polycomb repressive complex mtr04120   Ubiquitin mediated proteolysis mtr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:mtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     25499080    04120 Ubiquitin mediated proteolysis     25499080   09126 Chromosome    03083 Polycomb repressive complex     25499080  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mtr04131]     25499080    04121 Ubiquitin system [BR:mtr04121]     25499080    03036 Chromosome and associated proteins [BR:mtr03036]     25499080 Membrane trafficking [BR:mtr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     25499080 Ubiquitin system [BR:mtr04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      25499080    Cul7 complex      25499080 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      25499080   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      25499080 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  25499080 NCBI-ProteinID:  XP_024626823 LinkDB All DBs Position 7:44432371..44433620 Genome browser AA seq 157 aa AA seqDB search MSSITKKMITLKSSNGETFEVSEAVALQSQTIKGMMEENCGNNGIPILNVKSKILAKVTE YCKMHVEASKTLAKGIDYCEKQVDADTANSNDLKAWDAKFMKKTDMKTLCDLMLAANYLN IKGLLDLTCRAVPDLVRGKTLRKWYNKEFVLGEFVLD NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atgtcttcaataacgaagaagatgatcactttgaagagttccaacggtgaaaccttcgag gtttccgaggcggtggcacttcaatcgcagacaatcaagggcatgatggaggagaattgt ggcaacaacggaatccctattcttaacgtgaagagcaagatattggcaaaggtgactgaa tactgtaagatgcatgtcgaggccagcaagacattggcgaagggaattgattactgtgag aagcaagttgatgccgacaccgcgaattccaatgatcttaaagcttgggatgctaaattc atgaagaagactgatatgaaaacgctttgcgatctcatgctggctgcgaattacttgaac atcaagggtctgctggatcttacctgtcgggctgtaccggatcttgttcgagggaagaca ttgagaaaatggtacaacaaagagtttgttcttggagaatttgttttagactaa

DBGET integrated database retrieval system