Medicago truncatula (barrel medic): 25501511 Help Entry 25501511          CDS       T01716                                  Name (RefSeq) probable histone H2B.3   KO K11252   histone H2B Organism mtr  Medicago truncatula (barrel medic) Brite KEGG Orthology (KO) [BR:mtr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mtr03036]     25501511   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mtr04147]     25501511 Chromosome and associated proteins [BR:mtr03036]  Eukaryotic type   Nucleosome assembly factors    Histones     25501511 Exosome [BR:mtr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    25501511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone Motif Other DBs NCBI-GeneID:  25501511 NCBI-ProteinID:  XP_013446206 UniProt:  A0A072TTP4 LinkDB All DBs Position 8:32143608..32143898 Genome browser AA seq 96 aa AA seqDB search MAKAVEKKVAEKRPTKKKDTEKKIPKEGETWKKRSKKSIETYKIYIFKVLKQVHPAIGVS SKAMGVINSFVNDIFKKLAQELLRLVRYYIDTNFNI NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagccgtagagaaaaaagtagctgagaagagaccaacgaagaagaaggacaca gagaagaaaatcccaaaggaaggagaaacatggaaaaagagatcaaagaaaagcattgaa acctacaagatatatatattcaaggttctcaaacaagttcatcctgccattggtgtttca agtaaagctatgggagttattaacagtttcgtgaacgatatctttaagaaactcgctcaa gaactgttgagactcgtgcgttattatatagatacgaattttaacatataa

DBGET integrated database retrieval system