Medicago truncatula (barrel medic): 5333112 Help Entry 5333112           CDS       T01716                                  Symbol atpH, MetrCp053 Name (RefSeq) ATP synthase CF0 C subunit   KO K02110   F-type H+-transporting ATPase subunit c Organism mtr  Medicago truncatula (barrel medic) Pathway mtr00190   Oxidative phosphorylation mtr00195   Photosynthesis mtr01100   Metabolic pathways Module mtr_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mtr00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     5333112 (atpH)    00195 Photosynthesis     5333112 (atpH)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mtr00194]     5333112 (atpH) Photosynthesis proteins [BR:mtr00194]  Photosystem and electron transport system   F-type ATPase [OT]    5333112 (atpH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-GeneID:  5333112 NCBI-ProteinID:  YP_001381723 UniProt:  I3T0H2 LinkDB All DBs Position Pltd:complement(76162..76407) Genome browser AA seq 81 aa AA seqDB search MDPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEDKIRGTLLLSLAFM EALTIYGLVVALALLFANPFV NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggatccactgatttctgctgcttctgttatcgctgctgggttggccgtcgggcttgct tctattggacctggagttggtcaaggtacagctgcagggcaagctgtagaagggattgcg cgacaaccggaagcagaggacaaaataaggggtactttattacttagtctggcttttatg gaagctttaactatttatgggctggttgtagcattagcacttttatttgccaatcctttt gtttaa

DBGET integrated database retrieval system