Micromonospora tulbaghiae: CSH63_30955 Help Entry CSH63_30955       CDS       T05651                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mtua  Micromonospora tulbaghiae Brite KEGG Orthology (KO) [BR:mtua00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CSH63_30955 Enzymes [BR:mtua01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CSH63_30955 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_2 Thioredoxin GST_N Motif Other DBs NCBI-ProteinID:  AYF31797 UniProt:  A0A386WTN4 LinkDB All DBs Position complement(6614795..6615037) Genome browser AA seq 80 aa AA seqDB search MLTMYSTPWCGYCHRLKSQLDREGIAYEVVDIEQDPAAADFVMSVNGGNQTVPTLRFADG SALTNPSIVQVKQHLAALPG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgctgacgatgtattccaccccgtggtgcggctactgccaccggctgaagtcgcagctc gaccgggagggcatcgcgtacgaggtggtcgacatcgagcaggaccccgcggccgcggac ttcgtgatgagcgtcaacggcggcaaccagaccgtcccgacgctgcgcttcgccgacggc agcgccctgaccaacccctcgatcgtccaggtcaagcagcacctggccgcgctgcccggc tga

DBGET integrated database retrieval system