Mycobacterium tuberculosis CAS/NITR204: J113_13175 Help Entry J113_13175        CDS       T02652                                  Name (GenBank) D-amino acid oxidase   KO K00273   D-amino-acid oxidase [EC:1.4.3.3] Organism mtuc  Mycobacterium tuberculosis CAS/NITR204 Pathway mtuc00260   Glycine, serine and threonine metabolism mtuc00311   Penicillin and cephalosporin biosynthesis mtuc00330   Arginine and proline metabolism mtuc00470   D-Amino acid metabolism mtuc01100   Metabolic pathways mtuc01110   Biosynthesis of secondary metabolites mtuc04146   Peroxisome Brite KEGG Orthology (KO) [BR:mtuc00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     J113_13175    00330 Arginine and proline metabolism     J113_13175   09106 Metabolism of other amino acids    00470 D-Amino acid metabolism     J113_13175   09110 Biosynthesis of other secondary metabolites    00311 Penicillin and cephalosporin biosynthesis     J113_13175  09140 Cellular Processes   09141 Transport and catabolism    04146 Peroxisome     J113_13175 Enzymes [BR:mtuc01000]  1. Oxidoreductases   1.4  Acting on the CH-NH2 group of donors    1.4.3  With oxygen as acceptor     1.4.3.3  D-amino-acid oxidase      J113_13175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DAO DUF7846 Motif Other DBs NCBI-ProteinID:  AGL27352 UniProt:  R4MIT1 LinkDB All DBs Position complement(2145239..2145688) Genome browser AA seq 149 aa AA seqDB search MINCAGLGARELAGDATVWPRFGQHVVLTNPGLEKLFIERTGGSEWICYFAHPQRVVCGG ISIPGRWDPTPEPEITERILQRCRRIQPRLAEAAVIETITGLRPDRPSVRVEAEPIGRAL CIHNYGHGGDGVTLSWGCAREVVNLVGGG NT seq 450 nt NT seq  +upstreamnt  +downstreamnt gtgatcaactgtgctggtctgggcgctcgggaactggccggcgacgccacggtctggccg cggttcggccagcacgtcgtcctcaccaatccaggtctagagaaactgtttatcgagcgc accggcggctcggaatggatctgctactttgcccacccgcagcgtgtagtctgcggcggc atcagtatccctggcaggtgggaccccaccccagagccggagataaccgagcggatcctg caacggtgtcgccgcatacaaccacggcttgccgaggcggcagtgattgagacgattacc gggctgcgtcctgatcggccgtccgtgcgggtggaagctgaaccgatcgggcgagcgctg tgcatccacaactatggccacggaggtgacggcgtgaccctgtcatggggttgtgcgcgg gaggtggtcaatcttgtcggcggcggttaa

DBGET integrated database retrieval system