Mycobacterium tuberculosis EAI5/NITR206: J114_19575
Help
Entry
J114_19575 CDS
T02653
Name
(GenBank) peptide ABC transporter transmembrane protein
KO
K15582
oligopeptide transport system permease protein
Organism
mtue
Mycobacterium tuberculosis EAI5/NITR206
Pathway
mtue01501
beta-Lactam resistance
mtue02010
ABC transporters
mtue02024
Quorum sensing
Brite
KEGG Orthology (KO) [BR:
mtue00001
]
09130 Environmental Information Processing
09131 Membrane transport
02010 ABC transporters
J114_19575
09140 Cellular Processes
09145 Cellular community - prokaryotes
02024 Quorum sensing
J114_19575
09160 Human Diseases
09175 Drug resistance: antimicrobial
01501 beta-Lactam resistance
J114_19575
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mtue02000
]
J114_19575
Transporters [BR:
mtue02000
]
ABC transporters, prokaryotic type
Peptide and nickel transporters
Oligopeptide transporter
J114_19575
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
BPD_transp_1
Motif
Other DBs
NCBI-ProteinID:
AGL33172
LinkDB
All DBs
Position
complement(4082502..4083302)
Genome browser
AA seq
266 aa
AA seq
DB search
MIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGA
RASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMH
HRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVG
PVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALA
ITVLAFMMMGDALRDALDPASRAWRA
NT seq
801 nt
NT seq
+upstream
nt +downstream
nt
gtgatcgccgcggcgctgatcctgctgattcttgtcgtggcggcgtttccgtcgttgttt
accgcagccgatcccacctatgccgatcccagccaaagcatgcttgcgccatcggccgcg
cactggttcggcaccgacctgcagggccacgacatctattcgcgcacggtgtatggtgcg
cgggcttcggtcacggtcgggttgggggcaacgctggccgtgttcgtcgtgggcggggcg
ttaggcgcattggccggtttttacgggagctggatcgatgcggtggtttcgcgggtcacc
gatgtgtttctcggcttgccgttgctgttggccgccatcgtgctcatgcaagtcatgcat
caccgcacggtgtggacggtgatcgccatcttggcattgttcggctggccgcaagtggcc
aggatcgcgcgcggtgcggtgctcgaggtgcgtgccagcgattacgtccttgcagctaag
gcattggggttgaataggtttcagattctgcttcggcacgcgctgcccaacgccgtgggc
ccggtgatcgcggtggctaccgtcgctctggggatcttcatcgtcaccgaggccacgctg
tcctacctcggggtcggattgccgacgtcggtggtgtcctggggtggcgacatcaatgtc
gcgcagacccggctacggtcgggctcgccaattttgttctatcctgcgggcgcgctggcg
attacggtgctggcgttcatgatgatgggcgacgctttgcgcgacgcgctggatccggct
tcgcgggcatggcgggcatga
DBGET
integrated database retrieval system