KEGG   Mycobacterium tuberculosis Haarlem/NITR202: I917_25650
Entry
I917_25650        CDS       T02654                                 
Name
(GenBank) Putative Dipeptide-transport integral membrane protein ABC transporter DppC
  KO
K15582  oligopeptide transport system permease protein
Organism
mtuh  Mycobacterium tuberculosis Haarlem/NITR202
Pathway
mtuh01501  beta-Lactam resistance
mtuh02010  ABC transporters
mtuh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtuh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    I917_25650
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    I917_25650
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    I917_25650
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtuh02000]
    I917_25650
Transporters [BR:mtuh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Oligopeptide transporter
    I917_25650
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: AGL25203
UniProt: R4M7S9
LinkDB
Position
complement(4096229..4097029)
AA seq 266 aa
MIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGA
RASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRXTDVFLGLPLLLAAIVLMQVMH
HRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVG
PVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALA
ITVLAFMMMGDALRDALDPASRAWRA
NT seq 801 nt   +upstreamnt  +downstreamnt
gtgatcgccgcggcgctgatcctgctgattcttgtcgtggcggcgtttccgtcgttgttt
accgcagccgatcccacctatgccgatcccagccaaagcatgcttgcgccatcggccgcg
cactggttcggcaccgacctgcagggccacgacatctattcgcgcacggtgtatggtgcg
cgggcttcggtcacggtcgggttgggggcaacgctggccgtgttcgtcgtgggcggggcg
ttaggcgcattggccggtttttacgggagctggatcgatgcggtggtttcgcgggkcacc
gatgtgtttctcggcttgccgttgctgttggccgccatcgtgctcatgcaagtcatgcat
caccgcacggtgtggacggtgatcgccatcttggcattgttcggctggccgcaagtggcc
aggatcgcgcgcggtgcggtgctcgaggtgcgtgccagcgattacgtccttgcagctaag
gcattggggttgaataggtttcagattctgcttcggcacgcgctgcccaacgccgtgggc
ccggtgatcgcggtggctaccgtcgctctggggatcttcatcgtcaccgaggccacgctg
tcctacctcggggtcggattgccgacgtcggtggtgtcctggggtggcgacatcaatgtc
gcgcagacccggctacggtcgggctcgccaattttgttctatcctgcgggcgcgctggcg
attacggtgctggcgttcatgatgatgggcgacgctttgcgcgacgcgctggatccggct
tcgcgggcatggcgggcatga

DBGET integrated database retrieval system