Methylocella tundrae: MTUNDRAET4_4170
Help
Entry
MTUNDRAET4_4170 CDS
T05970
Name
(GenBank) conserved protein of unknown function
KO
K03924
MoxR-like ATPase [EC:3.6.3.-]
Organism
mtun
Methylocella tundrae
Brite
KEGG Orthology (KO) [BR:
mtun00001
]
09190 Not Included in Pathway or Brite
09191 Unclassified: metabolism
99980 Enzymes with EC numbers
MTUNDRAET4_4170
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
AAA_3
AAA_lid_2
AAA_5
bpMoxR
MCM
Sigma54_activat
AAA
Motif
Other DBs
NCBI-ProteinID:
VFU11051
UniProt:
A0A4U8Z672
LinkDB
All DBs
Position
1:3789495..3790496
Genome browser
AA seq
333 aa
AA seq
DB search
MAEAVTASFEAAMERSAETALDRIAAARAAIETIIFGQTQVVEEALVTLLSGGHGLLVGV
PGLAKTKLVETLGIVLGLNARRVQFTPDLMPADILGSEVLEESSDRRRSFRFVQGPIFAQ
LLMADEINRASPRTQSALLQAMQEYHVSVAGERHDLPQPFHVLATQNPLEQEGTYPLPEA
QLDRFLMQIDVGYPDRAAERRILVETTGAAQAEARHVINAEELMGIQRLVRRLPIGDSVI
EAILDVVRSARPGEGDPAITQHIAWGPGPRAAQALMLATRARALIGGRLSPSNDDVAALA
VPILKHRMALTFSARAEGETITDLIAKLTQRLR
NT seq
1002 nt
NT seq
+upstream
nt +downstream
nt
atggcagaagcagtgacagcctccttcgaagccgccatggagcgcagcgccgaaaccgcg
ctggatcgcatcgcggccgcgcgggctgcgatcgaaacgatcattttcggccagacccag
gtggtggaagaagctctggtgacgcttctgtcgggtggccacggcctcctcgtcggcgtg
ccgggcctcgccaagaccaagctcgtcgagacccttggaattgtgctcggcctcaatgcg
cgccgcgtgcagttcacgccggatctcatgccggcggacatccttggctccgaggtcctg
gaagaatcgagcgaccggcggcgcagcttccgtttcgtgcaaggtccgatcttcgcccaa
ttgctgatggccgacgagatcaaccgcgccagtccgcgcacccagtcggccctgcttcag
gcgatgcaggaatatcacgtttcggtcgcgggcgagcgccatgacctgccgcagcctttc
catgttctggcgacacaaaatccgctcgagcaggagggcacatatccgttgccggaagct
cagctcgaccgtttcctgatgcagatcgacgtcggctatccagaccgcgccgccgaaagg
cgcattctggtcgaaacgacgggcgcggcccaggccgaagccaggcatgtgatcaacgcc
gaggagttgatgggcattcagcggctggtgcgacggctgccgatcggcgacagcgtcatc
gaagcgatcctcgacgtcgtgcgctcggcgcgtccgggcgaaggcgatccggcgatcacg
cagcatatcgcctgggggccgggtccacgcgcggcgcaggccctgatgctggcgacccgg
gcgcgcgccttgattggcggccggctctcgccctcgaacgacgatgtcgcggcgctcgcc
gtgccgatcctgaagcaccgcatggcgctgacattttccgcccgcgccgaaggcgagacg
atcaccgatctcatcgccaagctcacacaacggctgcgctga
DBGET
integrated database retrieval system