Methylocella tundrae: MTUNDRAET4_4244 Help Entry MTUNDRAET4_4244   CDS       T05970                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mtun  Methylocella tundrae Pathway mtun01100   Metabolic pathways mtun01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtun00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MTUNDRAET4_4244    00074 Mycolic acid biosynthesis     MTUNDRAET4_4244   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MTUNDRAET4_4244 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding MS_N HNOB Motif Other DBs NCBI-ProteinID:  VFU11125 UniProt:  A0A4U8Z780 LinkDB All DBs Position 1:3864120..3864365 Genome browser AA seq 81 aa AA seqDB search MKDLDIRTALKEELGNIAPEIDINSVDPAADLRDALDIDSIDFLNFITAIHHRLEIEIPE IDYPRLRTLDGAVSFLKEKLG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaaagatctcgatatccgcacggcattaaaggaggaactcggaaacattgcgcctgaa atcgatataaattcggttgatcccgccgcagacctgcgggatgctcttgatattgattct attgatttccttaattttataactgcgatccaccatcgcctcgagatcgagataccggag atcgactatccaaggctcaggacgttggatggggccgtcagttttctcaaagagaagctt gggtga

DBGET integrated database retrieval system