Mycobacterium tuberculosis CCDC5079: CFBS_0999
Help
Entry
CFBS_0999 CDS
T02679
Symbol
uvrD1
Name
(GenBank) ATP-dependent DNA helicase II
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
mtur
Mycobacterium tuberculosis CCDC5079
Pathway
mtur03420
Nucleotide excision repair
mtur03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
mtur00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
CFBS_0999 (uvrD1)
03430 Mismatch repair
CFBS_0999 (uvrD1)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
mtur03400
]
CFBS_0999 (uvrD1)
Enzymes [BR:
mtur01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
CFBS_0999 (uvrD1)
DNA repair and recombination proteins [BR:
mtur03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
CFBS_0999 (uvrD1)
MMR (mismatch excision repair)
Other MMR factors
CFBS_0999 (uvrD1)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
UvrD_C_2
PcrA_UvrD_tudor
AAA_30
CarD_TRCF_RID
DUF3013
Motif
Other DBs
NCBI-ProteinID:
AGL99431
LinkDB
All DBs
Position
1056829..1059144
Genome browser
AA seq
771 aa
AA seq
DB search
MSVHATDAKPPGPSPADQLLDGLNPQQRQAVVHEGSPLLIVAGAGSGKTAVLTRRIAYLM
AARGVGVGQILAITFTNKAAAEMRERVVGLVGEKARYMWVSTFHSTCVRILRNQAALIEG
LNSNFSIYDADDSRRLLQMVGRDLGLDIKRYSPRLLANAISNLKNELIDPHQALAGLTED
SDDLARAVASVYDEYQRRLRAANALDFDDLIGETVAVLQAFPQIAQYYRRRFRHVLVDEY
QDTNHAQYVLVRELVGRDSNDGIPPGELCVVGDADQSIYAFRGATIRNIEDFERDYPDTR
TILLEQNYRSTQNILSAANSVIARNAGRREKRLWTDAGAGELIVGYVADNEHDEARFVAE
EIDALAEGSEITYNDVAVFYRTNNSSRSLEEVLIRAGIPYKVVGGVRFYERKEIRDIVAY
LRVLDNPGDAVSLRRILNTPRRGIGDRAEACVAVYAENTGVGFGDALVAAAQGKVPMLNT
RAEKAIAGFVEMFDELRGRLDDDLGELVEAVLERTGYRRELEASTDPQELARLDNLNELV
SVAHEFSTDRENAAALGPDDEDVPDTGVLADFLERVSLVADADEIPEHGAGVVTLMTLHT
AKGLEFPVVFVTGWEDGMFPHMRALDNPTELSEERRLAYVGITRARQRLYVSRAIVRSSW
GQPMLNPESRFLREIPQELIDWRRTAPKPSFSAPVSGAGRFGSARPSPTRSGASRRPLLV
LQVGDRVTHDKYGLGRVEEVSGVGESAMSLIDFGSSGRVKLMHNHAPVTKL
NT seq
2316 nt
NT seq
+upstream
nt +downstream
nt
atgagtgtgcacgcgaccgacgccaagcctcccggtccatccccagcggaccaactgctc
gacggcctcaacccgcaacagcgccaggcggtcgtgcatgagggttcgccgctgctgatc
gtcgcgggcgcgggttcgggtaagaccgcggtgttgacccgccgcattgcctatctgatg
gcggcccgcggcgtcggggtgggccagattctggccatcaccttcaccaacaaagccgcc
gccgagatgcgcgaacgggtggtgggcctggttggggagaaggcccggtacatgtgggtg
tcgacgtttcactccacctgcgtgcgtatcctgcgcaaccaggcggcgctgatcgagggc
ctcaactccaacttttcgatctatgacgccgacgattcgcggcggttgctgcagatggtg
ggccgcgacctgggcctagacatcaagcggtactcgccgcgactgctggctaacgccatc
tccaacctgaagaacgagttgatcgacccgcatcaggcgctggccggcttaacggaggac
tccgatgacctagcgcgcgccgtggcgtcggtttatgacgaataccagcggcggctgcgg
gcggccaacgcgctggacttcgacgacctgatcggcgagaccgtcgcggtgctgcaggcc
ttcccgcagatcgcccagtactaccgtcggaggttccggcatgtcctggttgacgaatac
caggacaccaaccacgcccagtacgtattggtgcgcgagctggtcggccgcgacagcaat
gacggtattccccccggcgagttgtgcgtcgtcggggatgccgatcagtcgatctatgcg
ttccgcggcgccaccatccgcaacatcgaagacttcgaacgtgactaccccgacaccaga
accattctgctggaacagaattaccgctcgacgcagaacatcctgtcggcggccaactcg
gtgattgcccgtaacgcggggcgccgggagaagcggttgtggaccgacgccggcgccggg
gagttgatcgttggctatgtcgccgacaacgagcacgacgaggcccggttcgtggccgag
gagatcgatgcgctcgccgagggtagcgagatcacctacaacgatgtcgccgtcttctac
cgcaccaacaactcgtcgcggtcactggaagaggtgctgatccgcgccggtattccgtac
aaggtcgttgggggagtgcgcttttacgagcgcaaggagattcgcgacatcgttgcctac
ctgcgcgtgctggacaacccgggcgacgcggtcagcctacggcgcatccttaacaccccg
cgccgcggtatcggggatcgtgccgaggcgtgtgtggcggtgtacgccgagaacaccggc
gtcggcttcggtgacgcgctcgtcgccgcggcccaaggcaaagtaccgatgctgaatacc
cgggcggagaaggcgatcgcgggtttcgtcgagatgttcgacgagctgcggggccgcctc
gatgacgacctgggggagctggtcgaggcggtgctggaacgcaccggataccgccgcgag
ctggaagcgtccaccgatccacaggaattggcccgcctggacaacctcaacgaattagtc
agcgtcgcacacgaattcagtaccgaccgggagaatgccgccgcacttggcccagacgac
gaagacgtccccgacaccggtgtgctggcggattttctggaacgggtgtcgctggtcgcc
gacgccgatgagatcccggagcatggcgcgggtgtggttaccttgatgaccttgcacacc
gccaagggtttggagttcccggtggtgtttgtgaccggctgggaggacgggatgttcccg
cacatgcgggcgttggacaacccgaccgagttgtccgaggagcggcggctggcctatgtc
ggcatcacccgcgcccggcagcggttgtacgtgagccgggcgatcgtgcgttcgtcttgg
ggccagccgatgctcaacccggagtcgcggtttctgcgggaaatcccgcaggagctcatc
gactggcggcgcaccgccccgaagccgtcgttcagtgccccggtgagtggcgccggtcgg
ttcggtagcgcgcgtccatcaccgacccgctcgggggcgagcaggcgcccgctgctggtg
cttcaggtcggcgaccgcgtgacccatgacaaatacggcctgggccgtgtcgaggaggtc
tccggtgtcggcgaatcggcgatgtcgctgatcgacttcggtagctcggggcgggtgaag
ctgatgcacaaccacgcccctgtcaccaagctctga
DBGET
integrated database retrieval system