Mycobacterium tuberculosis CCDC5079: CFBS_1416
Help
Entry
CFBS_1416 CDS
T02679
Symbol
clpS
Name
(GenBank) ATP-dependent Clp protease adaptor protein ClpS
KO
K06891
ATP-dependent Clp protease adaptor protein ClpS
Organism
mtur
Mycobacterium tuberculosis CCDC5079
Brite
KEGG Orthology (KO) [BR:
mtur00001
]
09190 Not Included in Pathway or Brite
09192 Unclassified: genetic information processing
99975 Protein processing
CFBS_1416 (clpS)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ClpS
Motif
Other DBs
NCBI-ProteinID:
AGL99848
LinkDB
All DBs
Position
1502235..1502540
Genome browser
AA seq
101 aa
AA seq
DB search
MAVVSAPAKPGTTWQRESAPVDVTDRAWVTIVWDDPVNLMSYVTYVFQKLFGYSEPHATK
LMLQVHNEGKAVVSAGSRESMEVDVSKLHAAGLWATMQQDR
NT seq
306 nt
NT seq
+upstream
nt +downstream
nt
atggctgttgtgtcagcgcccgccaagccaggtaccacctggcagcgcgagtctgctccg
gtcgacgtgacggacagggcatgggtcaccatcgtgtgggacgacccggtcaacttgatg
agctacgtgacttacgtgtttcagaagttgttcggctacagcgagccgcatgccaccaag
ctgatgttgcaggtgcacaacgaaggtaaggcggtggtgtccgcgggcagccgagagtcc
atggaagtcgacgtgtccaagctgcatgccgccggtttgtgggcgacgatgcagcaggac
cggtga
DBGET
integrated database retrieval system