Mycobacterium tuberculosis CCDC5079: CFBS_1429 Help Entry CFBS_1429         CDS       T02679                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtur  Mycobacterium tuberculosis CCDC5079 Pathway mtur01100   Metabolic pathways mtur01110   Biosynthesis of secondary metabolites Module mtur_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mtur_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mtur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CFBS_1429    00074 Mycolic acid biosynthesis     CFBS_1429   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CFBS_1429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AGL99861 LinkDB All DBs Position 1510542..1510862 Genome browser AA seq 106 aa AA seqDB search MWRYPLSTRLALPNTPGVASFAMTSSPSTVSTTLLSILRDDLNIDLTRVTPDARLVDDVG LDSVAFAVGMVAIEERLGVALSEEELLTCDTVGELEAAIAAKYRDE NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgtggcgatatccactaagtacaaggctagccttgcctaataccccaggtgtagcctcc ttcgccatgacctcatcgccgtccaccgtcagcactacgctgctgagcatcctgcgcgac gacctcaacattgacctgactcgagtcacgcctgatgccaggttggtcgacgatgtggga ctggattcggtggccttcgcggtcggtatggtggccatcgaggagcggctcggagtcgca ctgtccgaagaggagctcttgacgtgcgacacggtcggagaactggaggcagcgatcgcg gccaaataccgcgatgagtga

DBGET integrated database retrieval system