Mycobacterium tuberculosis CCDC5079: CFBS_3383 Help Entry CFBS_3383         CDS       T02679                                  Name (GenBank) putative glutaredoxin protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mtur  Mycobacterium tuberculosis CCDC5079 Brite KEGG Orthology (KO) [BR:mtur00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CFBS_3383 Enzymes [BR:mtur01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CFBS_3383 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 Thioredoxin GST_N_3 Glrx-like SH3BGR Motif Other DBs NCBI-ProteinID:  AGM01816 LinkDB All DBs Position 3564119..3564373 Genome browser AA seq 84 aa AA seqDB search MITAALTIYTTSWCGYCLRLKTALTANRIAYDEVDIEHNRAAAEFVGSVNGGNRTVPTVK FADGSTLTNPSADEVKAKLVKIAG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgatcaccgctgcgctcaccatctatacgacatcatggtgtggctattgccttcgactc aaaacagcgctcacggccaaccgaatcgcttacgacgaggtcgacatcgaacacaaccgt gcggccgcggagttcgtcggctcggtcaatggcggcaacagaactgttcccacggtgaag ttcgccgacgggtcgacgctgactaacccgagcgcggacgaggtcaaagcgaagctggta aagatcgcgggttaa

DBGET integrated database retrieval system