Methylosinus trichosporium: CQW49_00540 Help Entry CQW49_00540       CDS       T05155                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mtw  Methylosinus trichosporium Pathway mtw00190   Oxidative phosphorylation mtw01100   Metabolic pathways Module mtw_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mtw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CQW49_00540 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mtw00194]     CQW49_00540 (atpE) Photosynthesis proteins [BR:mtw00194]  Photosystem and electron transport system   F-type ATPase [OT]    CQW49_00540 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ATQ66546 UniProt:  A0A2D2CV74 LinkDB All DBs Position 110774..111019 Genome browser AA seq 81 aa AA seqDB search MDDIQYISVIAAAVAVSFGAIGPALAEGKAVAAAMEAIARQPEAAGVLSRTLFVGLAMIE TMAIYCLVIALLLLFANPFVK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggacgacatccaatatatcagcgtgatcgccgccgccgtcgccgtatccttcggagcg atcggtcccgctcttgcggaaggcaaggctgtcgcggccgccatggaggcgatcgcgcgt cagccggaggccgccggcgtcctgtcgcgcacccttttcgtcggcctcgcgatgatcgag accatggcgatctactgtctcgtgatcgcgcttctgcttctcttcgccaatcctttcgtc aaatag

DBGET integrated database retrieval system