Methylosinus trichosporium: CQW49_01630 Help Entry CQW49_01630       CDS       T05155                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism mtw  Methylosinus trichosporium Pathway mtw02024   Quorum sensing mtw03018   RNA degradation Brite KEGG Orthology (KO) [BR:mtw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CQW49_01630  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CQW49_01630  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:mtw03019]     CQW49_01630    03036 Chromosome and associated proteins [BR:mtw03036]     CQW49_01630 Messenger RNA biogenesis [BR:mtw03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CQW49_01630 Chromosome and associated proteins [BR:mtw03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CQW49_01630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 Motif Other DBs NCBI-ProteinID:  ATQ66739 UniProt:  A0A2D2CVR9 LinkDB All DBs Position complement(331326..331589) Genome browser AA seq 87 aa AA seqDB search MSSERAQNLQDTFLNFVRKNKVPLTIFLVNGVKLQGIVTWFDNFCLLLRRDGHSQLVYKH AISTIMPGHPIHMFEPGDDSEAAEKQR NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtcctcggaacgcgcgcagaacctgcaggatacttttttgaacttcgtgaggaaaaac aaggttccgctcacgattttcctcgtgaatggcgtcaagcttcaaggcattgtgacctgg ttcgacaatttttgtctgttgctgcggcgcgacggccattcgcagctcgtctacaaacat gcgatttccactatcatgcccggtcatccgatccatatgttcgagccgggagacgattcc gaggccgcggagaagcagcgctag

DBGET integrated database retrieval system