Methylosinus trichosporium: CQW49_07455 Help Entry CQW49_07455       CDS       T05155                                  Name (GenBank) HNH endonuclease   KO K07451   5-methylcytosine-specific restriction enzyme A [EC:3.1.21.-] Organism mtw  Methylosinus trichosporium Brite KEGG Orthology (KO) [BR:mtw00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02048 Prokaryotic defense system [BR:mtw02048]     CQW49_07455 Prokaryotic defense system [BR:mtw02048]  Restriction and modification system (R-M system)   Type IV R-M system    CQW49_07455 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HNH Motif Other DBs NCBI-ProteinID:  ATQ70275 UniProt:  A0A2D2D5N0 LinkDB All DBs Position complement(1559052..1559297) Genome browser AA seq 81 aa AA seqDB search MAWRAWYGLRRWRARAKAQLADEPLCRMCAAEGRVTAATVADHIEPHRGDPALFWAGALQ SLCAPHHNRAKQRAEAAARHP NT seq 246 nt NT seq  +upstreamnt  +downstreamnt ctggcgtggcgggcctggtatgggctgcggcgctggcgcgcgcgggccaaggcgcagctc gccgacgagccgctgtgccgcatgtgcgccgccgagggcagggtgacggcggcgaccgtc gccgatcacatcgagccccaccgcggcgaccccgcgctcttctgggccggcgccctgcag agcctatgcgccccgcaccacaaccgcgcgaagcagcgcgccgaggccgccgcccgccac ccctga

DBGET integrated database retrieval system