Methylosinus trichosporium: CQW49_17685 Help Entry CQW49_17685       CDS       T05155                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mtw  Methylosinus trichosporium Pathway mtw01100   Metabolic pathways mtw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mtw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CQW49_17685    00074 Mycolic acid biosynthesis     CQW49_17685   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CQW49_17685 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 Motif Other DBs NCBI-ProteinID:  ATQ69506 UniProt:  A0A2D2D3H4 LinkDB All DBs Position 3735705..3735944 Genome browser AA seq 79 aa AA seqDB search MSDVAERVKKIVVEHLGVEPDKVIDKANFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA ETILTVGDAVAFLEKAKAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgtcgccgagcgcgttaagaagatcgttgtcgaacatctcggcgtcgagccc gacaaggtgatcgacaaggcgaatttcatcgatgatctcggagccgactcgctcgacacg gtcgagctggtcatggccttcgaggaggagttcggcgtcgagattcccgacgacgcggcc gagacgattctcacggtcggcgacgctgtcgccttcctggaaaaagccaaggccgcctga

DBGET integrated database retrieval system