Methylosinus trichosporium: CQW49_18715
Help
Entry
CQW49_18715 CDS
T05155
Symbol
flgF
Name
(GenBank) flagellar biosynthesis protein FlgF
KO
K02391
flagellar basal-body rod protein FlgF
Organism
mtw
Methylosinus trichosporium
Pathway
mtw02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
mtw00001
]
09140 Cellular Processes
09142 Cell motility
02040 Flagellar assembly
CQW49_18715 (flgF)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02035 Bacterial motility proteins [BR:
mtw02035
]
CQW49_18715 (flgF)
Bacterial motility proteins [BR:
mtw02035
]
Flagellar system
Flagellar assembly proteins
Rod and hook
CQW49_18715 (flgF)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Flg_bbr_C
LlgE_F_G_D1
Flg_bb_rod
Motif
Other DBs
NCBI-ProteinID:
ATQ69686
UniProt:
A0A2D2D3Z7
LinkDB
All DBs
Position
complement(3970725..3971447)
Genome browser
AA seq
240 aa
AA seq
DB search
MQSAFYVSLSAQLSIDKRMETIANNIANAATAGYRADGVSFESVVTKTGADAVAYASAGR
DYVSRVAGDMQRTGDPFDVAVVRRAFFAIRTPDGVAYTRDGRMKMTETGDLQTVGGYPIL
DAGNSAVVLDPTAGPPMISRDGMINQAGRQIGAIGLFMIDGDVKLSRGPGASVIPDKPAT
AVLDFGRNGVEQGVVETANVNPVREMVKLISASRAFESVSSMNDLLDSSQRDAIRTIGGG
NT seq
723 nt
NT seq
+upstream
nt +downstream
nt
atgcaatcggccttctatgtctcgctctccgcgcagctgtcgatcgacaagcgcatggag
acgatcgccaacaacatcgccaacgccgccaccgccggctatcgcgccgatggcgtcagc
ttcgagagcgtcgttacgaagacgggggccgacgcggtcgcctatgcctcggcggggcgc
gactatgtctcccgcgtcgccggcgacatgcagcgcaccggcgatccgttcgacgtcgcc
gtcgtccggcgcgccttcttcgccattcgcacgccggatggcgtggcatacacgcgcgac
ggccgcatgaagatgaccgaaaccggcgatctgcagacggtcggcggatatccgatcctc
gacgccggcaattccgcggtcgtgctcgacccgaccgccggaccgccgatgatctcgcgc
gacggcatgatcaaccaagccggccgccagatcggcgcgataggcctgttcatgatcgac
ggcgacgtcaagctgtcgcgcggccccggcgccagcgtcatcccggataagccggcgaca
gcggttctcgacttcgggcgcaacggcgtcgagcagggcgtcgtcgaaaccgccaatgtc
aatccggttcgcgagatggtgaagctcatctccgcctcgcgcgccttcgagagcgtcagc
tcgatgaatgatctgctcgacagctcgcaacgcgacgcgattcgcacgatcggcggcggc
tga
DBGET
integrated database retrieval system