Methylosinus trichosporium: CQW49_19230 Help Entry CQW49_19230       CDS       T05155                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mtw  Methylosinus trichosporium Pathway mtw00190   Oxidative phosphorylation mtw01100   Metabolic pathways Module mtw_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mtw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CQW49_19230  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mtw00194]     CQW49_19230 Photosynthesis proteins [BR:mtw00194]  Photosystem and electron transport system   F-type ATPase [OT]    CQW49_19230 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  ATQ69777 UniProt:  A0A2D2D464 LinkDB All DBs Position 4074931..4075158 Genome browser AA seq 75 aa AA seqDB search MADASSFQLIGAGLAAIGTGAAAIGVGIIFGNFVNGALRNPSAAAGQFTNAIIGAALAEG LGIFAFLIAILLYLK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggctgatgcgtcttccttccagctgatcggcgcgggcctcgccgccatcggcacgggc gccgccgcgatcggcgtcggcatcatcttcggcaatttcgtgaacggcgcgctgcgcaat ccgtcggccgccgccggccagttcaccaacgccatcatcggcgcggcgctcgccgaaggt ctcggcatcttcgcgttcctgatcgcgatcctgctctacctgaagtaa

DBGET integrated database retrieval system