Mucilaginibacter celer: HYN43_023270 Help Entry HYN43_023270      CDS       T05668                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism muh  Mucilaginibacter celer Pathway muh01100   Metabolic pathways muh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:muh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HYN43_023270    00074 Mycolic acid biosynthesis     HYN43_023270   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HYN43_023270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AYL98028 UniProt:  A0A494W3A1 LinkDB All DBs Position 5647917..5648180 Genome browser AA seq 87 aa AA seqDB search MDKLIADLKEQIIEQLNLQDVKPEDIGDDQPLFGDGLGLDSIDALELIVLLQQKYKVKLS NAEDGPKIFRSVRTIAEFIEEYKASNA NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atggataaattaatcgccgatctgaaagagcagatcattgagcagttgaacttacaggat gtaaagccggaggatataggcgatgatcagccgctttttggtgatggccttggtttggat tcgatagacgctttagaactgatcgtattattgcagcagaagtataaagtaaagctatcc aatgccgaggacggcccgaaaattttccggtcggtacgcaccattgcggagtttattgag gaatataaagcttcgaacgcctaa

DBGET integrated database retrieval system