Mesitornis unicolor (brown roatelo): 104534550 Help Entry 104534550         CDS       T08455                                  Symbol CAV1 Name (RefSeq) caveolin-1   KO K06278   caveolin 1 Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04144   Endocytosis mui04510   Focal adhesion mui05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mui00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104534550 (CAV1)   09144 Cellular community - eukaryotes    04510 Focal adhesion     104534550 (CAV1)  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     104534550 (CAV1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mui04131]     104534550 (CAV1) Membrane trafficking [BR:mui04131]  Endocytosis   Lipid raft mediated endocytosis    Caveolin-mediated endocytosis     104534550 (CAV1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Caveolin Motif Other DBs NCBI-GeneID:  104534550 NCBI-ProteinID:  XP_010190779 LinkDB All DBs Position Unknown AA seq 125 aa AA seqDB search RLTDLTLCSLLQIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLTAIFGIPLAL IWGIYFAILSFLHIWAVVPCIRSYLIEIQCISRIYSIFIHTFCDPLYEAIGKMFSNIRAT VRKEI NT seq 380 nt NT seq  +upstreamnt  +downstreamnt atcgcctgactgacctgactttgtgttctttgctgcagattgattttgaagatgtgattg ctgagccagaggggacacacagctttgatgggatttggaaggccagttttaccaccttca ctgtaaccaaatactggttttatcgtttactgacagcaatctttggcattcctcttgctc tcatctggggcatctactttgccattttgtcattcctgcacatctgggcggtggtgccgt gcataaggagctacctgattgagatccagtgcattagccgcatctattcgatcttcatcc acacgttctgcgacccattgtatgaggccataggcaaaatgttcagcaacatccgagcca cagtacggaaagagatttga

DBGET integrated database retrieval system