Mesitornis unicolor (brown roatelo): 104535039 Help Entry 104535039         CDS       T08455                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04010   MAPK signaling pathway mui04012   ErbB signaling pathway mui04068   FoxO signaling pathway mui04137   Mitophagy - animal mui04140   Autophagy - animal mui04150   mTOR signaling pathway mui04210   Apoptosis mui04218   Cellular senescence mui04370   VEGF signaling pathway mui04371   Apelin signaling pathway mui04540   Gap junction mui04625   C-type lectin receptor signaling pathway mui04810   Regulation of actin cytoskeleton mui04910   Insulin signaling pathway mui04912   GnRH signaling pathway mui04916   Melanogenesis Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104535039 (NRAS)    04012 ErbB signaling pathway     104535039 (NRAS)    04370 VEGF signaling pathway     104535039 (NRAS)    04371 Apelin signaling pathway     104535039 (NRAS)    04068 FoxO signaling pathway     104535039 (NRAS)    04150 mTOR signaling pathway     104535039 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104535039 (NRAS)    04137 Mitophagy - animal     104535039 (NRAS)   09143 Cell growth and death    04210 Apoptosis     104535039 (NRAS)    04218 Cellular senescence     104535039 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     104535039 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104535039 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104535039 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     104535039 (NRAS)    04912 GnRH signaling pathway     104535039 (NRAS)    04916 Melanogenesis     104535039 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mui04131]     104535039 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mui04147]     104535039 (NRAS)    04031 GTP-binding proteins [BR:mui04031]     104535039 (NRAS) Membrane trafficking [BR:mui04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104535039 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     104535039 (NRAS) Exosome [BR:mui04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104535039 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    104535039 (NRAS)   Exosomal proteins of breast cancer cells    104535039 (NRAS)   Exosomal proteins of colorectal cancer cells    104535039 (NRAS) GTP-binding proteins [BR:mui04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104535039 (NRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104535039 NCBI-ProteinID:  XP_010183093 LinkDB All DBs Position Unknown AA seq 153 aa AA seqDB search QDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLY REQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAF YTLVREIRQYRMKKLNSNEDGNQGCLGLSCVVM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt caggactcgtacagaaagcaggttgtcattgatggagagacgtgcttgttagacatcctg gacactgcgggccaggaggagtacagcgccatgcgcgatcagtacatgagaactggggaa ggattcctctgcgtctttgccattaacaacagtaaatcatttgctgatattaacctttac agagaacagatcaagagagtgaaagattcggatgatgtgccaatggtgctagttgggaat aagtgtgatttgcccacaagaacagtagacacaaaacaggctcaagaattagcaaaaagc tatgggatccccttcatagagacatctgctaaaacaagacagggtgtggaagatgctttt tacacactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaatgaagat gggaatcaaggctgtttgggattgtcttgcgttgtgatgtga

DBGET integrated database retrieval system