Mesitornis unicolor (brown roatelo): 104535130 Help Entry 104535130         CDS       T08455                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04137   Mitophagy - animal mui04140   Autophagy - animal mui04144   Endocytosis mui04145   Phagosome mui04148   Efferocytosis mui05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mui00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104535130 (RAB7A)    04145 Phagosome     104535130 (RAB7A)    04140 Autophagy - animal     104535130 (RAB7A)    04137 Mitophagy - animal     104535130 (RAB7A)    04148 Efferocytosis     104535130 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104535130 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mui04131]     104535130 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mui04147]     104535130 (RAB7A)    04031 GTP-binding proteins [BR:mui04031]     104535130 (RAB7A) Membrane trafficking [BR:mui04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     104535130 (RAB7A) Exosome [BR:mui04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104535130 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    104535130 (RAB7A)   Exosomal proteins of colorectal cancer cells    104535130 (RAB7A)   Exosomal proteins of bladder cancer cells    104535130 (RAB7A) GTP-binding proteins [BR:mui04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     104535130 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  104535130 NCBI-ProteinID:  XP_010191774 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggagtggga aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggcgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacgatttcagtctctgggagtcgccttctacagggga gcagactgctgtgttctggtgtttgatgtcacggcccccaacacattcaaaaccctagac agctggagggatgaattcctcattcaggccagtccgagagatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaacgaccgagtgaaggct tctgcagagagctgcagctgctga

DBGET integrated database retrieval system