Mesitornis unicolor (brown roatelo): 104536216 Help Entry 104536216         CDS       T08455                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04010   MAPK signaling pathway mui04068   FoxO signaling pathway mui04081   Hormone signaling mui04114   Oocyte meiosis mui04140   Autophagy - animal mui04150   mTOR signaling pathway mui04810   Regulation of actin cytoskeleton mui04910   Insulin signaling pathway mui04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104536216 (INS)    04150 mTOR signaling pathway     104536216 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104536216 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104536216 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mui04052]     104536216 (INS) Cytokines and neuropeptides [BR:mui04052]  Neuropeptides   Unclassified    104536216 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104536216 NCBI-ProteinID:  XP_010177077 UniProt:  A0A091QUF4 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSSPGTSHAAANQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVNGPLHGEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcactgcctctcctggcccttcttgctctttccagccctggg accagccatgcagctgccaaccagcatctctgtggctcccatttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaagccagaagggacattgagcaa cctctagtgaacggtcccttgcatggcgaggtaggagaactgcccttccagcaggaggag tttgagaaagtgaagcgagggatagtggagcaatgctgccacaacacctgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system