Mesitornis unicolor (brown roatelo): 104537759 Help Entry 104537759         CDS       T08455                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04621   NOD-like receptor signaling pathway mui05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mui00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     104537759 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104537759 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mui03110]     104537759 (TXN) Chaperones and folding catalysts [BR:mui03110]  Protein folding catalysts   Protein disulfide isomerase    104537759 (TXN) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_8 AhpC-TSA Thioredoxin_2 Thioredoxin_7 DIM1 OST3_OST6 Glutaredoxin Thioredoxin_9 Redoxin TraF Motif Other DBs NCBI-GeneID:  104537759 NCBI-ProteinID:  XP_010179037 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search SEFEAELKSAAEKLVVVDFSATWCGPCKMIKPFFHSLCEKYGDVVFIEIDVDDAQDVAAH CDVKCMPTFQFYKNGKKVQEFSGANKEKLEETIKSLV NT seq 294 nt NT seq  +upstreamnt  +downstreamnt tctgaatttgaggcagaactgaagtctgctgctgagaagcttgtagtagttgatttctct gccacatggtgtggaccgtgcaaaatgatcaagcctttcttccatagtttgtgtgaaaag tatggtgatgtggtgttcatcgaaattgacgtggatgatgcacaggatgttgctgcacac tgcgatgtgaagtgtatgccaacgttccagttctacaagaacggaaagaaggtgcaggag ttctctggggccaacaaagagaagctggaagagaccattaaaagtctagtctaa

DBGET integrated database retrieval system