Mesitornis unicolor (brown roatelo): 104538275 Help Entry 104538275         CDS       T08455                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04060   Cytokine-cytokine receptor interaction mui04218   Cellular senescence mui04620   Toll-like receptor signaling pathway mui04621   NOD-like receptor signaling pathway mui04622   RIG-I-like receptor signaling pathway mui05132   Salmonella infection mui05164   Influenza A Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104538275  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104538275  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104538275    04621 NOD-like receptor signaling pathway     104538275    04622 RIG-I-like receptor signaling pathway     104538275  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104538275   09171 Infectious disease: bacterial    05132 Salmonella infection     104538275  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mui04052]     104538275    00536 Glycosaminoglycan binding proteins [BR:mui00536]     104538275 Cytokines and neuropeptides [BR:mui04052]  Cytokines   Chemokines    104538275 Glycosaminoglycan binding proteins [BR:mui00536]  Heparan sulfate / Heparin   Chemokines    104538275 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104538275 NCBI-ProteinID:  XP_010179723 LinkDB All DBs Position Unknown AA seq 103 aa AA seqDB search MGKAVTAVLTLLLISLLAAEGKALPRSAIELRCQCIGTHSKFIHPKFIHNVNLIPSGPHC KDVEVIATLTDGREVCLEPTAPWVKLIIKAILDKANAKPETVS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgggcaaggctgtgactgccgtcctgaccctgctcctcatctcactgctggcagcagaa ggtaaggccctgccacgctcagcgattgaactccgatgccagtgcatagggacccattcc aagttcatccaccccaagttcatccacaacgtgaacctcatccccagtggacctcactgc aaggacgttgaagtcatagcgaccctgacagacggcagagaagtgtgcctggagcccacg gctccctgggtgaagctgatcatcaaggccatcctggacaaggcaaacgccaaacctgag acagtgtcctaa

DBGET integrated database retrieval system