Mesitornis unicolor (brown roatelo): 104541897 Help Entry 104541897         CDS       T08455                                  Symbol PROK1 Name (RefSeq) prokineticin-1   KO K24191   prokineticin Organism mui  Mesitornis unicolor (brown roatelo) Brite KEGG Orthology (KO) [BR:mui00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mui04052]     104541897 (PROK1) Cytokines and neuropeptides [BR:mui04052]  Cytokines   Chemokines    104541897 (PROK1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prokineticin DUF6132 Motif Other DBs NCBI-GeneID:  104541897 NCBI-ProteinID:  XP_010184353 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search ACERDPQCGPGTCCAVSLWLRGLRMCTPLGQEGDECHPFSHNVPFFGKRQHHACPCLPNF VCSRFLAGRYRCSINFKNVDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gcctgcgagcgggaccctcagtgcggccccgggacctgctgcgccgtcagcctctggctg cgggggctgcggatgtgcacccccctggggcaggaaggggacgagtgccacccgttcagt cacaatgtcccctttttcggcaagcgccagcaccacgcctgcccctgtttgcccaatttc gtctgctctcggttcctcgccggccgctaccgctgctccatcaacttcaagaacgtggat ttttag

DBGET integrated database retrieval system