Mesitornis unicolor (brown roatelo): 104543676 Help Entry 104543676         CDS       T08455                                  Symbol CLDN19 Name (RefSeq) claudin-19   KO K06087   claudin Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui03272   Virion - Hepatitis viruses mui04382   Cornified envelope formation mui04514   Cell adhesion molecule (CAM) interaction mui04530   Tight junction Brite KEGG Orthology (KO) [BR:mui00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104543676 (CLDN19)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104543676 (CLDN19)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104543676 (CLDN19)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104543676 (CLDN19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mui03037]     104543676 (CLDN19)    04147 Exosome [BR:mui04147]     104543676 (CLDN19) Cilium and associated proteins [BR:mui03037]  Other cilia and associated proteins   Stereociliary proteins    104543676 (CLDN19) Exosome [BR:mui04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104543676 (CLDN19)   Exosomal proteins of colorectal cancer cells    104543676 (CLDN19) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 CD20 H_PPase SUR7 Motif Other DBs NCBI-GeneID:  104543676 NCBI-ProteinID:  XP_010186641 LinkDB All DBs Position Unknown AA seq 183 aa AA seqDB search HGGDECDREEGRDGLTQEIRSQDRVKGRFIPSVGRGDLVESSAAVAESTDWQRLFFPPPL AVHIQTSRALMVISLLLGFFGIIVSVVGMKCTKVGEEDPVTKSRIAVAGGVLFLLSGLCT LAAVSLYAAQVTYEFFRKSTVPINARYEFGSALFVAFPGVGGEVHKRRRPDGLHLLVPRL DRY NT seq 553 nt NT seq  +upstreamnt  +downstreamnt tcatggtggggatgagtgtgacagggaagaaggtcgtgacgggttgacacaagaaatacg cagccaggacagggttaagggcaggttcatccccagcgtgggacgaggtgaccttgttga gagcagcgcagctgtggccgaaagcacagactggcagcggcttttcttccctccacctct tgcagttcacatccagacctcccgggctctcatggtgatttctctcctcctgggcttctt cggcatcatcgtgagcgtggtgggcatgaaatgcaccaaggttggtgaagaagatcccgt taccaagagccgcattgctgttgctggtggtgtcctcttcctcctctccggtctgtgcac actggccgccgtgtccttgtatgcagcacaggtgacctacgagttcttcaggaagagcac tgtccccatcaatgccaggtacgagttcggctcggctctcttcgtcgcgttccccggagt gggcggtgaagtccacaaacgccggcgtcccgatggcctccacctccttgtacctcgcct cgaccgctactaa

DBGET integrated database retrieval system