Mesitornis unicolor (brown roatelo): 104544169 Help Entry 104544169         CDS       T08455                                  Symbol MRAS Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui04010   MAPK signaling pathway mui04137   Mitophagy - animal mui04140   Autophagy - animal mui04218   Cellular senescence mui04371   Apelin signaling pathway mui04519   Cadherin signaling mui04625   C-type lectin receptor signaling pathway mui04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:mui00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104544169 (MRAS)    04371 Apelin signaling pathway     104544169 (MRAS)   09133 Signaling molecules and interaction    04519 Cadherin signaling     104544169 (MRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104544169 (MRAS)    04137 Mitophagy - animal     104544169 (MRAS)   09143 Cell growth and death    04218 Cellular senescence     104544169 (MRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104544169 (MRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104544169 (MRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:mui04031]     104544169 (MRAS) GTP-binding proteins [BR:mui04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104544169 (MRAS) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 MMR_HSR1_Xtn Motif Other DBs NCBI-GeneID:  104544169 NCBI-ProteinID:  XP_010187257 UniProt:  A0A091SF47 LinkDB All DBs Position Unknown AA seq 208 aa AA seqDB search MATSAVPSENLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVYSVTDKASFEHVDRFHQLILRVKDRESFP MILVANKVDLMHLRKITREQGREMATKHNIPYIETSAKDPPLNVDKAFHDLVRVIRQQIP EKSQKKKKKTKWRGDRATGSHKLQCVIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggctacaagtgctgttcccagcgaaaatctccccacatacaaactggtggtggttgga gatggtggcgtggggaagagtgctctcaccatccagtttttccagaagatttttgtgcca gactatgacccaaccattgaagactcctacctgaagcacacagaaatagatgggcaatgg gcaattcttgatgtgctggatactgcgggccaagaggagttcagcgcaatgcgggagcag tacatgaggactggagatggttttcttatagtctactcagtgacagacaaggcgagcttc gagcacgtggaccggttccaccagctgatcctcagagtcaaggacagagagtcctttcca atgattttggtggcaaacaaagttgatctaatgcatttacggaaaattacaagagaacaa ggaagagaaatggcaacaaaacataatattccctacatagaaactagcgccaaggaccca cctctaaatgttgacaaggccttccatgatctcgtgagggtcataaggcaacagatccca gagaaaagccagaagaagaagaaaaagaccaaatggcgaggggacagagccacgggctcc cacaaactccagtgcgtgattttgtga

DBGET integrated database retrieval system