Mesitornis unicolor (brown roatelo): 104544817 Help Entry 104544817         CDS       T08455                                  Name (RefSeq) claudin-11   KO K06087   claudin Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui03272   Virion - Hepatitis viruses mui04382   Cornified envelope formation mui04514   Cell adhesion molecule (CAM) interaction mui04530   Tight junction Brite KEGG Orthology (KO) [BR:mui00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104544817  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104544817  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104544817  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104544817  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mui03037]     104544817    04147 Exosome [BR:mui04147]     104544817 Cilium and associated proteins [BR:mui03037]  Other cilia and associated proteins   Stereociliary proteins    104544817 Exosome [BR:mui04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104544817   Exosomal proteins of colorectal cancer cells    104544817 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin zf-LITAF-like Claudin_2 Motif Other DBs NCBI-GeneID:  104544817 NCBI-ProteinID:  XP_010188090 LinkDB All DBs Position Unknown AA seq 123 aa AA seqDB search MIAASVLGLPAIFLLITVLPCIRMGHEPGAAKYRRSQLGGILIILLAMCGVVATIWFPVC AHRETTIMSFGYSLYTGWIGSALCLFGGCVIVCCSGDAQTFGENRFYYASGSSSPTHAKS AHV NT seq 372 nt NT seq  +upstreamnt  +downstreamnt atgatcgccgcctctgtcctgggtcttcccgctatcttcttgctgataacagtcttgccc tgcatccgaatgggccatgagcctggagctgccaagtaccgtcggtcccagctgggaggg atcctcatcatcctcttggccatgtgcggtgtcgttgcgacgatctggtttcccgtgtgt gcccaccgcgagaccaccatcatgagcttcggctactccctgtacacgggctggatcggc tctgccctctgcctctttggtggctgcgtcatcgtctgctgctcgggagatgcccagaca ttcggtgaaaaccgtttctactatgcctcggggtccagctcccccacccacgcaaagagc gctcacgtgtaa

DBGET integrated database retrieval system