Mesitornis unicolor (brown roatelo): 104547802 Help Entry 104547802         CDS       T08455                                  Symbol CDO1 Name (RefSeq) cysteine dioxygenase type 1   KO K00456   cysteine dioxygenase [EC:1.13.11.20] Organism mui  Mesitornis unicolor (brown roatelo) Pathway mui00270   Cysteine and methionine metabolism mui00430   Taurine and hypotaurine metabolism mui01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:mui00001]  09100 Metabolism   09105 Amino acid metabolism    00270 Cysteine and methionine metabolism     104547802 (CDO1)   09106 Metabolism of other amino acids    00430 Taurine and hypotaurine metabolism     104547802 (CDO1) Enzymes [BR:mui01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.20  cysteine dioxygenase      104547802 (CDO1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  CDO_I PCO_ADO Motif Other DBs NCBI-GeneID:  104547802 NCBI-ProteinID:  XP_010191934 LinkDB All DBs Position Unknown AA seq 144 aa AA seqDB search YTRNLVDNGNGKFNLMILCWGEGHGSSIHDHTDSHCFMKILQGNLKETLFEWPEKKGNGE MTKKSERVLRENQCAYINDSIGLHRVENISHTEPAVSLHLYSPPFDTCNTFDQRTGHRHK VKMTFYSQFGERTLCATAVPQENN NT seq 436 nt NT seq  +upstreamnt  +downstreamnt gtatacaagaaatcttgtggacaatggaaatggaaagttcaacttgatgatcttgtgctg gggtgaaggacatggcagcagcatccatgatcacactgactcgcactgctttatgaagat ccttcagggaaatctaaaggagactctgtttgaatggcctgagaaaaaagggaatggtga aatgactaagaaatcagaacgagttttgagggaaaatcaatgtgcctacattaatgactc cattggcctgcaccgcgtggagaacataagccacacagagcctgctgtcagcctgcattt gtacagcccacccttcgatacctgcaacacctttgatcagaggactggacacaggcacaa agtcaagatgactttctacagccagtttggagaaaggactctctgtgcaacagcagtgcc gcaggagaacaactga

DBGET integrated database retrieval system