Mycobacterium ulcerans: MUL_4043 Help Entry MUL_4043          CDS       T00435                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mul  Mycobacterium ulcerans Pathway mul01100   Metabolic pathways mul01110   Biosynthesis of secondary metabolites Module mul_M00885   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA) mul_M00886   Meromycolic acid biosynthesis, initiation and elongation FAS II (KasA and KasB) Brite KEGG Orthology (KO) [BR:mul00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MUL_4043    00074 Mycolic acid biosynthesis     MUL_4043   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MUL_4043 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3683 Motif Other DBs NCBI-ProteinID:  ABL06098 Pasteur:  MUL_4043 UniProt:  A0PUS9 LinkDB All DBs Position complement(4512286..4512528) Genome browser AA seq 80 aa AA seqDB search MNPLDQAILSVIASLAPDHMAPVTVDSYLVDDLGYDSPRKMELVAALENRLQMRLKDPEI PLETVGEVIGWVNRHVGETA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacccactcgatcaagcgattctgtccgttatcgcgtcgctggcgcccgaccacatg gcaccggtaaccgtcgattcgtatctggttgatgacttgggctatgactcgccacgcaag atggaactcgtcgcggccttggagaaccgcctgcagatgcggctcaaagatcccgaaatc ccgctcgagacggtgggcgaagtgatcgggtgggtcaaccggcacgtgggcgagacggcg tag

DBGET integrated database retrieval system