Mycobacterium ulcerans: MUL_4413 Help Entry MUL_4413          CDS       T00435                                  Name (GenBank) conserved hypothetical protein   KO K04093   chorismate mutase [EC:5.4.99.5] Organism mul  Mycobacterium ulcerans Pathway mul00400   Phenylalanine, tyrosine and tryptophan biosynthesis mul01100   Metabolic pathways mul01110   Biosynthesis of secondary metabolites mul01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:mul00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     MUL_4413 Enzymes [BR:mul01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      MUL_4413 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Knl1_RWD_C DUF4140 Motif Other DBs NCBI-ProteinID:  ABL06404 Pasteur:  MUL_4413 UniProt:  A0PVN5 LinkDB All DBs Position 4895350..4895664 Genome browser AA seq 104 aa AA seqDB search MRPEPPPHENAELEMNTETIDTEDLPSIDELREEIDRLDREILAAVKRRAEVSQAIGKAR MASGGTRLVHNREMKVIERYSELGPEGKDLAILLLRLGRGRLGH NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagaccagaacccccacctcacgagaacgcggagttagaaatgaacaccgaaacaatc gacactgaagatctccccagcattgacgagctgcgcgaagagatcgaccggttggaccgc gagatcctggccgcggtcaagcggcgcgccgaggtgtctcaggcgatcggcaaggcccgg atggcctccggcggcacccgactggtgcacaaccgcgagatgaaggtcatcgagcgctac agcgagctgggacccgagggtaaagacctggcaattctgcttttgcggttgggtagaggt cgactcggccactaa

DBGET integrated database retrieval system