Pseudoduganella umbonata: FCL38_02910 Help Entry FCL38_02910       CDS       T06138                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism mum  Pseudoduganella umbonata Brite KEGG Orthology (KO) [BR:mum00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mum03036]     FCL38_02910    03400 DNA repair and recombination proteins [BR:mum03400]     FCL38_02910 Chromosome and associated proteins [BR:mum03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     FCL38_02910 DNA repair and recombination proteins [BR:mum03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       FCL38_02910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS DUF2570 HTH_21 Sap1_N Motif Other DBs NCBI-ProteinID:  QCP09483 UniProt:  A0A4P8HIU2 LinkDB All DBs Position 693173..693466 Genome browser AA seq 97 aa AA seqDB search MTTYQEYQAKIAELQKQAELARRNEISEAKERIATIMREHNLTLADLGPAVKSTKPVKPR APVPMKYRDEATGQTWTGRGRAPKWLEGRAKEEFLIK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgacgacttaccaggaataccaggccaagatcgctgaattgcagaagcaggctgaattg gcccgtcggaatgaaatttccgaagcgaaggagcgcatcgcaacgatcatgcgtgaacac aacctgaccctggcggacctgggcccggccgtcaaatcgacaaagcccgtcaagccgcgc gcgccggtaccgatgaaataccgtgacgaagccaccggccagacctggactggccgtggc cgcgcgccgaaatggctggaaggccgcgcaaaggaagagttcctgatcaagtaa

DBGET integrated database retrieval system