KEGG   Meriones unguiculatus (Mongolian gerbil): 110541927
Entry
110541927         CDS       T05884                                 
Symbol
Mrap
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04927  Cortisol synthesis and secretion
mun04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mun00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    110541927 (Mrap)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110541927 (Mrap)
SSDB
Motif
Pfam: MRAP EVC2_like
Other DBs
NCBI-GeneID: 110541927
NCBI-ProteinID: XP_021484283
LinkDB
Position
Unknown
AA seq 140 aa
MSLWQTLGSTATAMANRTNASVLYTGYEYYLDYIDLPPVDEKKLKANKHSIVIAFWVSLA
TFVVLLFLILLYMSWSGCPQMRHSPQAHQICPWGHSLNLPFCLRRVSLQTTEEPGSRTDT
DQWLQQESPSASHPAPLDLP
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagcctctggcagacactgggctccacagccacagccatggccaacaggaccaacgcc
tccgtcctgtacaccggttacgagtactacctggactacatagacctccctcctgtggac
gagaagaagctgaaagccaacaagcattccatcgtcattgccttttgggtgagcctggct
actttcgtggtgctcctcttcctcattctgctctacatgtcctggtcaggctgcccacag
atgaggcacagtcctcaggcccaccaaatatgtccatggggtcacagcctcaacctcccc
ttttgcctccggagggtctccctgcagacaacagaggagccaggaagcagaacagacaca
gaccaatggttacagcaggaaagtccttctgcctcacaccctgcacctctggatctcccc
tag

DBGET integrated database retrieval system