KEGG   Meriones unguiculatus (Mongolian gerbil): 110553796
Entry
110553796         CDS       T05884                                 
Symbol
Mapk1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X2
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun01521  EGFR tyrosine kinase inhibitor resistance
mun01522  Endocrine resistance
mun01524  Platinum drug resistance
mun04010  MAPK signaling pathway
mun04012  ErbB signaling pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04062  Chemokine signaling pathway
mun04066  HIF-1 signaling pathway
mun04068  FoxO signaling pathway
mun04071  Sphingolipid signaling pathway
mun04072  Phospholipase D signaling pathway
mun04114  Oocyte meiosis
mun04140  Autophagy - animal
mun04148  Efferocytosis
mun04150  mTOR signaling pathway
mun04151  PI3K-Akt signaling pathway
mun04210  Apoptosis
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04270  Vascular smooth muscle contraction
mun04350  TGF-beta signaling pathway
mun04360  Axon guidance
mun04370  VEGF signaling pathway
mun04371  Apelin signaling pathway
mun04380  Osteoclast differentiation
mun04510  Focal adhesion
mun04520  Adherens junction
mun04540  Gap junction
mun04550  Signaling pathways regulating pluripotency of stem cells
mun04611  Platelet activation
mun04613  Neutrophil extracellular trap formation
mun04620  Toll-like receptor signaling pathway
mun04621  NOD-like receptor signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04650  Natural killer cell mediated cytotoxicity
mun04657  IL-17 signaling pathway
mun04658  Th1 and Th2 cell differentiation
mun04659  Th17 cell differentiation
mun04660  T cell receptor signaling pathway
mun04662  B cell receptor signaling pathway
mun04664  Fc epsilon RI signaling pathway
mun04666  Fc gamma R-mediated phagocytosis
mun04668  TNF signaling pathway
mun04713  Circadian entrainment
mun04720  Long-term potentiation
mun04722  Neurotrophin signaling pathway
mun04723  Retrograde endocannabinoid signaling
mun04724  Glutamatergic synapse
mun04725  Cholinergic synapse
mun04726  Serotonergic synapse
mun04730  Long-term depression
mun04810  Regulation of actin cytoskeleton
mun04910  Insulin signaling pathway
mun04912  GnRH signaling pathway
mun04914  Progesterone-mediated oocyte maturation
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04917  Prolactin signaling pathway
mun04919  Thyroid hormone signaling pathway
mun04921  Oxytocin signaling pathway
mun04926  Relaxin signaling pathway
mun04928  Parathyroid hormone synthesis, secretion and action
mun04929  GnRH secretion
mun04930  Type II diabetes mellitus
mun04933  AGE-RAGE signaling pathway in diabetic complications
mun04934  Cushing syndrome
mun04935  Growth hormone synthesis, secretion and action
mun04960  Aldosterone-regulated sodium reabsorption
mun05010  Alzheimer disease
mun05020  Prion disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05034  Alcoholism
mun05132  Salmonella infection
mun05133  Pertussis
mun05135  Yersinia infection
mun05140  Leishmaniasis
mun05142  Chagas disease
mun05145  Toxoplasmosis
mun05152  Tuberculosis
mun05160  Hepatitis C
mun05161  Hepatitis B
mun05163  Human cytomegalovirus infection
mun05164  Influenza A
mun05165  Human papillomavirus infection
mun05166  Human T-cell leukemia virus 1 infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05170  Human immunodeficiency virus 1 infection
mun05171  Coronavirus disease - COVID-19
mun05200  Pathways in cancer
mun05203  Viral carcinogenesis
mun05205  Proteoglycans in cancer
mun05206  MicroRNAs in cancer
mun05207  Chemical carcinogenesis - receptor activation
mun05208  Chemical carcinogenesis - reactive oxygen species
mun05210  Colorectal cancer
mun05211  Renal cell carcinoma
mun05212  Pancreatic cancer
mun05213  Endometrial cancer
mun05214  Glioma
mun05215  Prostate cancer
mun05216  Thyroid cancer
mun05218  Melanoma
mun05219  Bladder cancer
mun05220  Chronic myeloid leukemia
mun05221  Acute myeloid leukemia
mun05223  Non-small cell lung cancer
mun05224  Breast cancer
mun05225  Hepatocellular carcinoma
mun05226  Gastric cancer
mun05230  Central carbon metabolism in cancer
mun05231  Choline metabolism in cancer
mun05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mun05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110553796 (Mapk1)
   04015 Rap1 signaling pathway
    110553796 (Mapk1)
   04350 TGF-beta signaling pathway
    110553796 (Mapk1)
   04668 TNF signaling pathway
    110553796 (Mapk1)
   04066 HIF-1 signaling pathway
    110553796 (Mapk1)
   04068 FoxO signaling pathway
    110553796 (Mapk1)
   04072 Phospholipase D signaling pathway
    110553796 (Mapk1)
   04071 Sphingolipid signaling pathway
    110553796 (Mapk1)
   04024 cAMP signaling pathway
    110553796 (Mapk1)
   04022 cGMP-PKG signaling pathway
    110553796 (Mapk1)
   04151 PI3K-Akt signaling pathway
    110553796 (Mapk1)
   04150 mTOR signaling pathway
    110553796 (Mapk1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    110553796 (Mapk1)
   04148 Efferocytosis
    110553796 (Mapk1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110553796 (Mapk1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    110553796 (Mapk1)
   04613 Neutrophil extracellular trap formation
    110553796 (Mapk1)
   04620 Toll-like receptor signaling pathway
    110553796 (Mapk1)
   04650 Natural killer cell mediated cytotoxicity
    110553796 (Mapk1)
   04660 T cell receptor signaling pathway
    110553796 (Mapk1)
   04658 Th1 and Th2 cell differentiation
    110553796 (Mapk1)
   04659 Th17 cell differentiation
    110553796 (Mapk1)
   04657 IL-17 signaling pathway
    110553796 (Mapk1)
   04662 B cell receptor signaling pathway
    110553796 (Mapk1)
   04664 Fc epsilon RI signaling pathway
    110553796 (Mapk1)
   04666 Fc gamma R-mediated phagocytosis
    110553796 (Mapk1)
   04062 Chemokine signaling pathway
    110553796 (Mapk1)
  09152 Endocrine system
   04929 GnRH secretion
    110553796 (Mapk1)
   04915 Estrogen signaling pathway
    110553796 (Mapk1)
   04917 Prolactin signaling pathway
    110553796 (Mapk1)
   04921 Oxytocin signaling pathway
    110553796 (Mapk1)
   04926 Relaxin signaling pathway
    110553796 (Mapk1)
   04935 Growth hormone synthesis, secretion and action
    110553796 (Mapk1)
   04919 Thyroid hormone signaling pathway
    110553796 (Mapk1)
   04928 Parathyroid hormone synthesis, secretion and action
    110553796 (Mapk1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    110553796 (Mapk1)
  09156 Nervous system
   04724 Glutamatergic synapse
    110553796 (Mapk1)
   04725 Cholinergic synapse
    110553796 (Mapk1)
   04726 Serotonergic synapse
    110553796 (Mapk1)
   04720 Long-term potentiation
    110553796 (Mapk1)
   04730 Long-term depression
    110553796 (Mapk1)
   04723 Retrograde endocannabinoid signaling
    110553796 (Mapk1)
   04722 Neurotrophin signaling pathway
    110553796 (Mapk1)
  09158 Development and regeneration
   04360 Axon guidance
    110553796 (Mapk1)
   04380 Osteoclast differentiation
    110553796 (Mapk1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    110553796 (Mapk1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110553796 (Mapk1)
   05206 MicroRNAs in cancer
    110553796 (Mapk1)
   05205 Proteoglycans in cancer
    110553796 (Mapk1)
   05207 Chemical carcinogenesis - receptor activation
    110553796 (Mapk1)
   05208 Chemical carcinogenesis - reactive oxygen species
    110553796 (Mapk1)
   05203 Viral carcinogenesis
    110553796 (Mapk1)
   05230 Central carbon metabolism in cancer
    110553796 (Mapk1)
   05231 Choline metabolism in cancer
    110553796 (Mapk1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110553796 (Mapk1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110553796 (Mapk1)
   05212 Pancreatic cancer
    110553796 (Mapk1)
   05225 Hepatocellular carcinoma
    110553796 (Mapk1)
   05226 Gastric cancer
    110553796 (Mapk1)
   05214 Glioma
    110553796 (Mapk1)
   05216 Thyroid cancer
    110553796 (Mapk1)
   05221 Acute myeloid leukemia
    110553796 (Mapk1)
   05220 Chronic myeloid leukemia
    110553796 (Mapk1)
   05218 Melanoma
    110553796 (Mapk1)
   05211 Renal cell carcinoma
    110553796 (Mapk1)
   05219 Bladder cancer
    110553796 (Mapk1)
   05215 Prostate cancer
    110553796 (Mapk1)
   05213 Endometrial cancer
    110553796 (Mapk1)
   05224 Breast cancer
    110553796 (Mapk1)
   05223 Non-small cell lung cancer
    110553796 (Mapk1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110553796 (Mapk1)
   05170 Human immunodeficiency virus 1 infection
    110553796 (Mapk1)
   05161 Hepatitis B
    110553796 (Mapk1)
   05160 Hepatitis C
    110553796 (Mapk1)
   05171 Coronavirus disease - COVID-19
    110553796 (Mapk1)
   05164 Influenza A
    110553796 (Mapk1)
   05163 Human cytomegalovirus infection
    110553796 (Mapk1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110553796 (Mapk1)
   05165 Human papillomavirus infection
    110553796 (Mapk1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    110553796 (Mapk1)
   05133 Pertussis
    110553796 (Mapk1)
   05152 Tuberculosis
    110553796 (Mapk1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    110553796 (Mapk1)
   05140 Leishmaniasis
    110553796 (Mapk1)
   05142 Chagas disease
    110553796 (Mapk1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110553796 (Mapk1)
   05020 Prion disease
    110553796 (Mapk1)
   05022 Pathways of neurodegeneration - multiple diseases
    110553796 (Mapk1)
  09165 Substance dependence
   05034 Alcoholism
    110553796 (Mapk1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110553796 (Mapk1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    110553796 (Mapk1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    110553796 (Mapk1)
   04934 Cushing syndrome
    110553796 (Mapk1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    110553796 (Mapk1)
   01524 Platinum drug resistance
    110553796 (Mapk1)
   01522 Endocrine resistance
    110553796 (Mapk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mun01001]
    110553796 (Mapk1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mun03036]
    110553796 (Mapk1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110553796 (Mapk1)
Enzymes [BR:mun01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     110553796 (Mapk1)
Protein kinases [BR:mun01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   110553796 (Mapk1)
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     110553796 (Mapk1)
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110553796 (Mapk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Haspin_kinase STATB_N FTA2 Kdo
Other DBs
NCBI-GeneID: 110553796
NCBI-ProteinID: XP_021501610
LinkDB
Position
17:complement(21716471..21774738)
AA seq 358 aa
MAAAVAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQ
TYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLS
NDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTG
FLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILG
ILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRI
EVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1077 nt   +upstreamnt  +downstreamnt
atggcggcggcggtggcggcgggtccggagatggtccgcgggcaggtgttcgacgtgggg
ccgcgctacaccaacctctcgtacatcggggaaggcgcctacggcatggtttgctctgct
tacgataatctgaacaaagttcgagttgctatcaaaaaaatcagcccttttgagcaccag
acctactgccagagaaccctaagagagataaaaattttactgcgcttcagacatgagaac
atcatcggcatcaatgacatcatccgggcaccaaccattgagcaaatgaaggatgtatat
atagtgcaggacctcatggagacagatctgtacaagctcttgaagacacagcacctcagc
aatgaccatatctgctattttctttatcagatcctgagaggattaaaatatatccattca
gctaatgttctgcatcgtgacctcaagccttccaacctcctactgaacaccacctgcgat
ctcaagatttgtgactttggccttgcccgtgttgcagatccagatcatgaccacacaggg
ttcttgacagagtatgtagccacgcgctggtacagagctccagaaattatgttgaattcc
aagggttataccaagtctattgatatctggtctgtgggctgcatcctggcagagatgcta
tccaataggcctatcttcccagggaagcattatctggaccagctgaatcacatcctgggt
attcttggatctccatcacaggaagatctgaattgtataataaatttaaaagctagaaac
tacttgctttctctcccgcacaaaaacaaggtgccatggaacaggttgttcccaaatgct
gactccaaagctctggacttactggataaaatgttgacatttaaccctcacaagaggatt
gaagttgaacaggccctggcccatccatacctggaacaatactatgacccaagtgatgag
cccattgctgaagcaccgttcaagttcgacatggagttggatgacttaccgaaggagaag
ctcaaagaactcatttttgaagagactgctagattccagccaggatacagatcttaa

DBGET integrated database retrieval system