KEGG   Meriones unguiculatus (Mongolian gerbil): 110560702
Entry
110560702         CDS       T05884                                 
Name
(RefSeq) calmodulin-4-like
  KO
K02183  calmodulin
Organism
mun  Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04014  Ras signaling pathway
mun04015  Rap1 signaling pathway
mun04020  Calcium signaling pathway
mun04022  cGMP-PKG signaling pathway
mun04024  cAMP signaling pathway
mun04070  Phosphatidylinositol signaling system
mun04114  Oocyte meiosis
mun04218  Cellular senescence
mun04261  Adrenergic signaling in cardiomyocytes
mun04270  Vascular smooth muscle contraction
mun04371  Apelin signaling pathway
mun04625  C-type lectin receptor signaling pathway
mun04713  Circadian entrainment
mun04720  Long-term potentiation
mun04722  Neurotrophin signaling pathway
mun04728  Dopaminergic synapse
mun04740  Olfactory transduction
mun04744  Phototransduction
mun04750  Inflammatory mediator regulation of TRP channels
mun04910  Insulin signaling pathway
mun04912  GnRH signaling pathway
mun04915  Estrogen signaling pathway
mun04916  Melanogenesis
mun04921  Oxytocin signaling pathway
mun04922  Glucagon signaling pathway
mun04924  Renin secretion
mun04925  Aldosterone synthesis and secretion
mun04970  Salivary secretion
mun04971  Gastric acid secretion
mun05010  Alzheimer disease
mun05012  Parkinson disease
mun05022  Pathways of neurodegeneration - multiple diseases
mun05031  Amphetamine addiction
mun05034  Alcoholism
mun05133  Pertussis
mun05152  Tuberculosis
mun05163  Human cytomegalovirus infection
mun05167  Kaposi sarcoma-associated herpesvirus infection
mun05170  Human immunodeficiency virus 1 infection
mun05200  Pathways in cancer
mun05214  Glioma
mun05417  Lipid and atherosclerosis
mun05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mun00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    110560702
   04015 Rap1 signaling pathway
    110560702
   04371 Apelin signaling pathway
    110560702
   04020 Calcium signaling pathway
    110560702
   04070 Phosphatidylinositol signaling system
    110560702
   04024 cAMP signaling pathway
    110560702
   04022 cGMP-PKG signaling pathway
    110560702
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    110560702
   04218 Cellular senescence
    110560702
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    110560702
  09152 Endocrine system
   04910 Insulin signaling pathway
    110560702
   04922 Glucagon signaling pathway
    110560702
   04912 GnRH signaling pathway
    110560702
   04915 Estrogen signaling pathway
    110560702
   04921 Oxytocin signaling pathway
    110560702
   04916 Melanogenesis
    110560702
   04924 Renin secretion
    110560702
   04925 Aldosterone synthesis and secretion
    110560702
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    110560702
   04270 Vascular smooth muscle contraction
    110560702
  09154 Digestive system
   04970 Salivary secretion
    110560702
   04971 Gastric acid secretion
    110560702
  09156 Nervous system
   04728 Dopaminergic synapse
    110560702
   04720 Long-term potentiation
    110560702
   04722 Neurotrophin signaling pathway
    110560702
  09157 Sensory system
   04744 Phototransduction
    110560702
   04740 Olfactory transduction
    110560702
   04750 Inflammatory mediator regulation of TRP channels
    110560702
  09159 Environmental adaptation
   04713 Circadian entrainment
    110560702
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110560702
  09162 Cancer: specific types
   05214 Glioma
    110560702
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110560702
   05163 Human cytomegalovirus infection
    110560702
   05167 Kaposi sarcoma-associated herpesvirus infection
    110560702
  09171 Infectious disease: bacterial
   05133 Pertussis
    110560702
   05152 Tuberculosis
    110560702
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110560702
   05012 Parkinson disease
    110560702
   05022 Pathways of neurodegeneration - multiple diseases
    110560702
  09165 Substance dependence
   05031 Amphetamine addiction
    110560702
   05034 Alcoholism
    110560702
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110560702
   05418 Fluid shear stress and atherosclerosis
    110560702
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mun01009]
    110560702
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mun04131]
    110560702
   03036 Chromosome and associated proteins [BR:mun03036]
    110560702
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mun04147]
    110560702
Protein phosphatases and associated proteins [BR:mun01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     110560702
Membrane trafficking [BR:mun04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    110560702
Chromosome and associated proteins [BR:mun03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     110560702
Exosome [BR:mun04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   110560702
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 Temptin_C Dockerin_1 p25-alpha UPF0154 DUF5580_M TerB SurA_N_2 vRNAP_dom SurA_N_3 DUF2666 DUF3939 DUF2267 FCaBP_EF-hand ExbD EF-hand_13 EcoRI_methylase HrpJ
Other DBs
NCBI-GeneID: 110560702
NCBI-ProteinID: XP_021512385
LinkDB
Position
19:22358449..22359387
AA seq 148 aa
MSHGFSEEQVQEFHAAFDSVDKNKDGKISKEELGDVMKKMGKHPTEEELKMLISKLDSDG
DGAINFEEFLAAMEKFKKGSTEQEMRAVFSVFDQNGDGHITLDELKQAMAQLGEKLSDEE
LNAMIREADVNEDGKVNYEEFVRILTEK
NT seq 447 nt   +upstreamnt  +downstreamnt
atgtctcacgggttttctgaggagcaggtgcaggagttccatgcagcctttgatagtgtt
gacaagaacaaagatggcaaaatcagcaaggaggagctgggtgatgtgatgaaaaagatg
ggcaagcaccccacagaggaagaactgaagatgctcatctccaagctggactcagatggt
gacggtgccatcaactttgaagaattcctggcggcaatggagaagtttaagaaggggagc
acagagcaggagatgcgggctgtgttcagtgtctttgaccagaatggtgatgggcacatc
accttggacgagctcaagcaggccatggcccagctgggagagaagctttcagatgaggag
ctgaatgccatgatccgtgaggccgatgtaaacgaggatgggaaggtgaactatgaggag
tttgtgcgcatcctcactgagaagtga

DBGET integrated database retrieval system