Meriones unguiculatus (Mongolian gerbil): 132646742
Help
Entry
132646742 CDS
T05884
Name
(RefSeq) interferon alpha-1-like
KO
K05414
interferon alpha
Organism
mun
Meriones unguiculatus (Mongolian gerbil)
Pathway
mun04060
Cytokine-cytokine receptor interaction
mun04151
PI3K-Akt signaling pathway
mun04217
Necroptosis
mun04620
Toll-like receptor signaling pathway
mun04621
NOD-like receptor signaling pathway
mun04622
RIG-I-like receptor signaling pathway
mun04623
Cytosolic DNA-sensing pathway
mun04630
JAK-STAT signaling pathway
mun04650
Natural killer cell mediated cytotoxicity
mun04936
Alcoholic liver disease
mun05152
Tuberculosis
mun05160
Hepatitis C
mun05161
Hepatitis B
mun05162
Measles
mun05163
Human cytomegalovirus infection
mun05164
Influenza A
mun05165
Human papillomavirus infection
mun05167
Kaposi sarcoma-associated herpesvirus infection
mun05168
Herpes simplex virus 1 infection
mun05169
Epstein-Barr virus infection
mun05170
Human immunodeficiency virus 1 infection
mun05171
Coronavirus disease - COVID-19
mun05200
Pathways in cancer
mun05320
Autoimmune thyroid disease
mun05417
Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:
mun00001
]
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
132646742
04151 PI3K-Akt signaling pathway
132646742
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
132646742
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
132646742
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
132646742
04621 NOD-like receptor signaling pathway
132646742
04622 RIG-I-like receptor signaling pathway
132646742
04623 Cytosolic DNA-sensing pathway
132646742
04650 Natural killer cell mediated cytotoxicity
132646742
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
132646742
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
132646742
05161 Hepatitis B
132646742
05160 Hepatitis C
132646742
05171 Coronavirus disease - COVID-19
132646742
05164 Influenza A
132646742
05162 Measles
132646742
05168 Herpes simplex virus 1 infection
132646742
05163 Human cytomegalovirus infection
132646742
05167 Kaposi sarcoma-associated herpesvirus infection
132646742
05169 Epstein-Barr virus infection
132646742
05165 Human papillomavirus infection
132646742
09171 Infectious disease: bacterial
05152 Tuberculosis
132646742
09163 Immune disease
05320 Autoimmune thyroid disease
132646742
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
132646742
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
132646742
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:
mun04052
]
132646742
Cytokines and neuropeptides [BR:
mun04052
]
Cytokines
Interferons
132646742
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Interferon
RIX1
Motif
Other DBs
NCBI-GeneID:
132646742
NCBI-ProteinID:
XP_060221220
LinkDB
All DBs
Position
12:complement(67755330..67756215)
Genome browser
AA seq
190 aa
AA seq
DB search
MSKPCVFLTVLVVLSCWSTCSLGCDLPHTHNLRNKRALTLLAQMRRLSPVSCLKDRKDFG
FPLEKENVQQIQKTQAIPVLNELTQQVLSLFSSKDSSSAWETTLLDTFCSGLHQQLQDLQ
VCLRQQVGVQESPLTQEDPVEAVRKYFHRITVYLREKKRSPCAWEVVRAQVWRALSSSAH
WLARRREEED
NT seq
573 nt
NT seq
+upstream
nt +downstream
nt
atgtcgaagccctgtgtcttcctgacggtcctggtggtgctgagctgctggtcaacctgc
tctctaggatgtgacctgcctcacacacataacctcaggaacaagagagccttgacactc
ctggcacaaatgaggagactctcccctgtctcctgcctcaaggacagaaaggactttgga
ttccctctggagaaggagaatgtccagcagatccagaagactcaagccatccctgtcctg
aatgagctgacccagcaggtcctgagcctcttcagctcaaaggactcctcttctgcttgg
gagacaaccctcctagacacattctgcagcggcctccaccagcagctccaggacctgcag
gtctgtctgaggcagcaggtcggggtgcaggaatctcccctgacccaggaggaccccgtg
gaggctgtgaggaagtacttccacaggatcactgtctacctgagagagaagaaacgcagc
ccctgtgcctgggaggtggtcagagcacaagtgtggagagccctgtcttcctcagcccac
tggctggccagacggagagaggaggaggactga
DBGET
integrated database retrieval system