Microcaecilia unicolor: 115461069 Help Entry 115461069         CDS       T09142                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism muo  Microcaecilia unicolor Pathway muo04060   Cytokine-cytokine receptor interaction muo04218   Cellular senescence muo04620   Toll-like receptor signaling pathway muo04621   NOD-like receptor signaling pathway muo04622   RIG-I-like receptor signaling pathway muo05132   Salmonella infection Brite KEGG Orthology (KO) [BR:muo00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     115461069  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     115461069  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     115461069    04621 NOD-like receptor signaling pathway     115461069    04622 RIG-I-like receptor signaling pathway     115461069  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     115461069  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:muo04052]     115461069    00536 Glycosaminoglycan binding proteins [BR:muo00536]     115461069 Cytokines and neuropeptides [BR:muo04052]  Cytokines   Chemokines    115461069 Glycosaminoglycan binding proteins [BR:muo00536]  Heparan sulfate / Heparin   Chemokines    115461069 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Dendrin Motif Other DBs NCBI-GeneID:  115461069 NCBI-ProteinID:  XP_030046482 UniProt:  A0A6P7X2R5 LinkDB All DBs Position 2:complement(398882218..398886015) Genome browser AA seq 105 aa AA seqDB search METKMRMFAAALIVCLLSASLTEAMSLARMGTELRCQCIKTESGFIPRRFIQNVQLFPSG PHCSNAEVIATLKSGQRVCLEPTAPWVERIIKKILEGSDRPESQL NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggaaaccaagatgagaatgtttgctgctgctctgattgtgtgcctgctttcagcgtcc ctaactgaagcaatgtcactggcacgaatgggaacggaactgcgttgccaatgtataaaa actgagtctggattcatcccccgcaggttcattcagaacgtgcagctcttcccaagtggc ccccactgcagcaacgctgaagtcattgcaacattaaagtctgggcagagagtgtgtttg gaaccaacagctccctgggtggaaagaatcatcaagaagattctagaaggctctgacaga ccagaaagtcagttataa

DBGET integrated database retrieval system