Microcaecilia unicolor: 115465031 Help Entry 115465031         CDS       T09142                                  Symbol RRAS Name (RefSeq) ras-related protein R-Ras   KO K07830   Ras-related protein R-Ras2 Organism muo  Microcaecilia unicolor Pathway muo04010   MAPK signaling pathway muo04137   Mitophagy - animal muo04140   Autophagy - animal muo04218   Cellular senescence muo04371   Apelin signaling pathway muo04625   C-type lectin receptor signaling pathway muo04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:muo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     115465031 (RRAS)    04371 Apelin signaling pathway     115465031 (RRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     115465031 (RRAS)    04137 Mitophagy - animal     115465031 (RRAS)   09143 Cell growth and death    04218 Cellular senescence     115465031 (RRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     115465031 (RRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     115465031 (RRAS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:muo04147]     115465031 (RRAS)    04031 GTP-binding proteins [BR:muo04031]     115465031 (RRAS) Exosome [BR:muo04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    115465031 (RRAS)   Exosomal proteins of bladder cancer cells    115465031 (RRAS) GTP-binding proteins [BR:muo04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     115465031 (RRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 DUF6806 Motif Other DBs NCBI-GeneID:  115465031 NCBI-ProteinID:  XP_030051290 UniProt:  A0A6P7XKV4 LinkDB All DBs Position 3:256741633..256767804 Genome browser AA seq 203 aa AA seqDB search MTTKESAALTMEKYKVVVVGGGGVGKSALTIQFIQSYFVSDYDPTIEDSYTKICTIDGKQ TRLDILDTAGQEEFGAMREQYMRTGEGFLLVFAINDRGSFNEISKFHTQILRVKDRDEFP MILVGNKADLDLQRQVSKEEVMSFARENRIPYMEASAKIRLNVDESFCELVRAIRKFQEL ESPPTPTLSPKQKEAKSCPCVLL NT seq 612 nt NT seq  +upstreamnt  +downstreamnt atgactacaaaggagtccgctgccctcaccatggagaagtataaagtggtagtagttgga ggagggggtgtcggtaaaagcgccctcaccatccagttcatccagtcttactttgtttcg gactatgacccaacgattgaggattcctacaccaaaatttgcaccattgatggcaaacaa acccgtctggacattctggatacagctggccaggaggagtttggagcgatgagagagcag tacatgcgcacaggagagggatttcttctagtcttcgccattaatgacaggggaagtttc aatgagatcagcaagtttcacacacagattctcagggtgaaggacagagacgagttcccc atgatcctcgtgggcaacaaggcggacctggacctccagagacaggtgtccaaagaggaa gtgatgagctttgcacgtgaaaaccggatcccgtacatggaggcctcagctaagatccga ctcaacgtggatgagtcattctgtgagttagttagagcgatcaggaagttccaggaactg gagagtcctcctacccccacgttaagcccaaagcagaaagaagccaaaagctgcccttgc gtccttttataa

DBGET integrated database retrieval system